LXL04_031334 | RubberDandelionOmics

Gene overview

LXL04_031334

Reference: OH-1004 Chr: Chr07 Coordinates: 4702231-4703881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

879 bp · LXL04_031334|LXL04_031334|OH1004|cDNA

ATGGGGGCGATTTCTATTTTGCACACAGTTTTTGGTATTTTCGGAGATGCAACTggtctcttcctcttcctcGCACCAACGATTACGTTTAAGAGGATAGTGAATAACAAATCCACTCAACAGTTCTCGGGGATTCCATACCCCATGACCTTGCTCAACTGCCTACTCTCAGCCTGGTATGGATTACCATTCATATCGCAAAACAACACACTGGTGACGGTTATCAACGGTACAGGAGCAGTGATCGAGTCTGTCTACGT...

CDS

Download CDS FASTA

879 bp · LXL04_031334|LXL04_031334|OH1004|CDS

ATGGGGGCGATTTCTATTTTGCACACAGTTTTTGGTATTTTCGGAGATGCAACTGGTCTCTTCCTCTTCCTCGCACCAACGATTACGTTTAAGAGGATAGTGAATAACAAATCCACTCAACAGTTCTCGGGGATTCCATACCCCATGACCTTGCTCAACTGCCTACTCTCAGCCTGGTATGGATTACCATTCATATCGCAAAACAACACACTGGTGACGGTTATCAACGGTACAGGAGCAGTGATCGAGTCTGTCTACGT...

Protein

Download Protein FASTA

292 aa · LXL04_031334|LXL04_031334|OH1004|PROTEIN

MGAISILHTVFGIFGDATGLFLFLAPTITFKRIVNNKSTQQFSGIPYPMTLLNCLLSAWYGLPFISQNNTLVTVINGTGAVIESVYVLIFILYAPKKEKAKVLGLLTFVLAAFSTVALVSVFALHGKTRRYFCGFAAAIFSVIMYGSPLSIMTTVIRTKSVEFMPFFLSLFVFLCGTSWFVFGLLGNDPFVYVCNGFGSVLGALQLVLYAIYRKNKGQKDEKLPSENETALEMGFVKPTADQPPDNNGRSLFLVLGANSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031334`
TK1151 ID	TkA08G101920
OH-1004 ID	LXL04_031334
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.598 / OH-1004 84.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031334

Location Chr07:4702231-4703881 (+)

Description Similar to SWEET1: Bidirectional sugar transporter SWEET1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21460`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0881300`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: B8AYH1`	Mediates transport of sugars across the plasma membrane.	No verified direct reference in this release
`Os05g0426000`	Mediates transport of sugars across the plasma membrane.	Plasma membrane-localized hexose transporter OsSWEET1b, affects sugar metabolism and leaf senescence.2024 · DOI: 10.1007/s00299-023-03125-3

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031334 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21460

dosa:Os01g0881300

dosa:Os05g0426000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.598

Rank 1 · LXL04_031334 · OH-1004

Lysosome / Vacuole0.169

Rank 2 · LXL04_031334 · OH-1004

Endoplasmic reticulum0.132

Rank 3 · LXL04_031334 · OH-1004

Cytoplasm0.110

Rank 4 · LXL04_031334 · OH-1004

Golgi apparatus0.082

Rank 5 · LXL04_031334 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083.22MtN3_slv10-97 aa

PF03083.22MtN3_slv133-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031334	`PF03083.22`	MtN3_slv	10	97	6e-41	139.1
LXL04_031334	`PF03083.22`	MtN3_slv	133	216	6e-41	139.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9J7`	Arabidopsis thaliana	Bidirectional sugar transporter SWEET1	66.667%	Swiss-Prot	strong database homology
`Q8RZQ8`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET1a	64.251%	Swiss-Prot	strong database homology
`B8AYH1`	Oryza sativa subsp. indica	Bidirectional sugar transporter SWEET1b	62.319%	Swiss-Prot	strong database homology
`Q60EC2`	Oryza sativa subsp. japonica	Bidirectional sugar transporter SWEET1b	61.836%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card