TkA08G101690 | RubberDandelionOmics

Gene overview

TkA08G101690

Reference: TK1151 Chr: Chr08 Coordinates: 26371403-26374757 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1471 bp · TkA08G101690|TK1151|cDNA

TATTTTAACAGCATATAAACCCTATCAGCGAAAACAATTTGGCCCTCTTTGAACAAGCCGACGCAGTCATCTTCTTCACTTCTGCTCCTCCGCGTCTGCTCCTTTCTCCACCCCGACGGTTGCCAGGCCGAGCTTCCTCCGACAAAGATTTGAAAAATATGGATGTGGAAGAAGTAACAGAGAAGGATAACAATGAAAGGGGAAAGAGACACAAAGGAAAACATGACAAACCAAAGCCATGGGATGATGAGACAGTTGAC...

CDS

Download CDS FASTA

1152 bp · TkA08G101690|TK1151|CDS

ATGGATGTGGAAGAAGTAACAGAGAAGGATAACAATGAAAGGGGAAAGAGACACAAAGGAAAACATGACAAACCAAAGCCATGGGATGATGAGACAGTTGACCATTGGAAGGTTGAAAAGTTTGACCCTTCTTGGAATGAAGGCGGTTTACTTGAAGTCAGCTCTTTCTCTACTCTCTTCCCTCAATACAGAGAGAAGTATCTGCAAGAAGCTTGGCCTATTGTTAAAGGTGCATTGAAAGAGCATGGGATTTCATGTGA...

Protein

Download Protein FASTA

383 aa · TkA08G101690|TK1151|PROTEIN

MDVEEVTEKDNNERGKRHKGKHDKPKPWDDETVDHWKVEKFDPSWNEGGLLEVSSFSTLFPQYREKYLQEAWPIVKGALKEHGISCELDLVKGSMTVSTTRKTRDPYIIVKSRDLIKLLSRSVPAPQAIKILNDEMQCDIIKIGGLVRNKEKFVKRRQRLVGPNSSTLKALEILTGCYILVQGNSVASMGSFKGLKQVRRIIEECMLNKMHPLYNIKVLMMRRDLASNPELANENWDRFLPKFKKKNVKQKKVKSKEKKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101690`
TK1151 ID	TkA08G101690
OH-1004 ID	LXL04_031330
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.084 / OH-1004 53.880 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G101690`
Location	Chr08:26371403-26374757 (+)
Description	Similar to KRR1: KRR1 small subunit processome component (Saccharomyces cerevisiae (strain Zymaflore VL3)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031330` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0030686 90S preribosome Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	sce:YCL059C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.779

Rank 1 · TkA08G101690 · TK1151

Cytoplasm0.251

Rank 2 · TkA08G101690 · TK1151

Cell membrane0.032

Rank 3 · TkA08G101690 · TK1151

Mitochondrion0.029

Rank 4 · TkA08G101690 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA08G101690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17903KH_KRR1_1st54-134 aa

PF21800KH_KRR1_2nd136-226 aa

PF22891KH_PNO1_2nd139-211 aa

PF22675KH-I_KHDC4-BBP157-185 aa

PF17903KH_KRR1_1st241-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101690	`PF17903`	KH_KRR1_1st	54	134	3.1e-31	108.1
TkA08G101690	`PF21800`	KH_KRR1_2nd	136	226	9.4e-42	141.7
TkA08G101690	`PF22891`	KH_PNO1_2nd	139	211	2.4e-05	24.8
TkA08G101690	`PF22675`	KH-I_KHDC4-BBP	157	185	0.074	13.6
TkA08G101690	`PF17903`	KH_KRR1_1st	241	254	3.1e-31	108.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card