LXL04_031330 | RubberDandelionOmics

Gene overview

LXL04_031330

Reference: OH-1004 Chr: Chr07 Coordinates: 4633297-4638518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2052 bp · LXL04_031330|LXL04_031330|OH1004|cDNA

ATGGCATCTTCTCTTCAATCTCAATATTTTTTTCCACATATTCTTCCACCACCATTTCCCGCCGGGACACCACCTTTTCCTCCTCATTTTGTGTCGCCGCCACCTCCTGTGACGCCTAGACCTTCGTCAGCACCTCCACATATCATCCCACCACCGTCACATACCATCTTACCACCACCACCACATGGTGTCCCACCACCGCCACATCATGCAGCACCGCCACCACCGTCACATGCTGTCCCACCTTCATCACATGTTGT...

CDS

Download CDS FASTA

2052 bp · LXL04_031330|LXL04_031330|OH1004|CDS

ATGGCATCTTCTCTTCAATCTCAATATTTTTTTCCACATATTCTTCCACCACCATTTCCCGCCGGGACACCACCTTTTCCTCCTCATTTTGTGTCGCCGCCACCTCCTGTGACGCCTAGACCTTCGTCAGCACCTCCACATATCATCCCACCACCGTCACATACCATCTTACCACCACCACCACATGGTGTCCCACCACCGCCACATCATGCAGCACCGCCACCACCGTCACATGCTGTCCCACCTTCATCACATGTTGT...

Protein

Download Protein FASTA

683 aa · LXL04_031330|LXL04_031330|OH1004|PROTEIN

MASSLQSQYFFPHILPPPFPAGTPPFPPHFVSPPPPVTPRPSSAPPHIIPPPSHTILPPPPHGVPPPPHHAAPPPPSHAVPPSSHVVPPPSPHVVPPSPHVVPPPSPHVVPPPPPHVVPPPPHIVPPPHVVPRPPPPHMIPPPPPHIVPPPPAPGNHTTIIVVVFVSCGGVFFLAFVMAALWCFLKKKKKMVRKAENVHIDEHRKVSERIVQGPHGTESVVLSVEDDIHIEEDMRKSEVENFRNGLHNLNGADLHINPIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031330`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_031330`
Location	Chr07:4633297-4638518 (+)
Description	Similar to KRR1: KRR1 small subunit processome component (Saccharomyces cerevisiae (strain Zymaflore VL3)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031330` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0030686 90S preribosome Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	sce:YCL059C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.407

Rank 1 · LXL04_031330 · OH-1004

Nucleus0.217

Rank 2 · LXL04_031330 · OH-1004

Cytoplasm0.185

Rank 3 · LXL04_031330 · OH-1004

Endoplasmic reticulum0.180

Rank 4 · LXL04_031330 · OH-1004

Golgi apparatus0.080

Rank 5 · LXL04_031330 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29364.1TED6159-199 aa

PF17903.8KH_KRR1_1st357-437 aa

PF21800.5KH_KRR1_2nd439-529 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031330	`PF29364.1`	TED6	159	199	6.4e-15	55.5
LXL04_031330	`PF17903.8`	KH_KRR1_1st	357	437	7.2e-31	106.9
LXL04_031330	`PF21800.5`	KH_KRR1_2nd	439	529	2.6e-41	140.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card