TkA08G101670 | RubberDandelionOmics

Gene overview

TkA08G101670

Reference: TK1151 Chr: Chr08 Coordinates: 26368261-26368740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA08G101670|TK1151|cDNA

ATGGAACCACGGATAGATCATGTGTCGTGTTTGGTTGATATGTATGGGAGGTGGGGGTATTTAAAAGAGGCGGAGGAGATAATCGGTAAAGTTGGATTTGAACCGAATGTGATTGTGTGGGGTACGTTTCTTGGGGCGTGTAGGATTCACGGGGATGAAAAGAGAGGGAAAAGGGCGAGTGATGAGTTGGCGAAATTGGAGCCTGAGAGTTCCGCTTCTTTTGTTTTGCTTTCGAATATTTATGCGGCTTCTGGGAATTG...

CDS

Download CDS FASTA

480 bp · TkA08G101670|TK1151|CDS

ATGGAACCACGGATAGATCATGTGTCGTGTTTGGTTGATATGTATGGGAGGTGGGGGTATTTAAAAGAGGCGGAGGAGATAATCGGTAAAGTTGGATTTGAACCGAATGTGATTGTGTGGGGTACGTTTCTTGGGGCGTGTAGGATTCACGGGGATGAAAAGAGAGGGAAAAGGGCGAGTGATGAGTTGGCGAAATTGGAGCCTGAGAGTTCCGCTTCTTTTGTTTTGCTTTCGAATATTTATGCGGCTTCTGGGAATTG...

Protein

Download Protein FASTA

159 aa · TkA08G101670|TK1151|PROTEIN

MEPRIDHVSCLVDMYGRWGYLKEAEEIIGKVGFEPNVIVWGTFLGACRIHGDEKRGKRASDELAKLEPESSASFVLLSNIYAASGNWEEVNFVRREMREKGVKKHPGCSWIKLGGETHLFVSGDELHLNSGEIYAILMELEGAMKDVVGNEYDVVDAIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101670`
TK1151 ID	TkA08G101670
OH-1004 ID	LXL04_031329
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 16.126 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G101670

Location Chr08:26368261-26368740 (+)

Description Similar to PCMP-E88: Pentatricopeptide repeat-containing protein At3g09040, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g09040`	Pentatricopeptide repeat-containing protein At3g09040, mitochondrial.	No verified direct reference in this release
`At4g02750`	Pentatricopeptide repeat-containing protein At4g02750.	No verified direct reference in this release
`At3g49142`	Putative pentatricopeptide repeat-containing protein At3g49142.	No verified direct reference in this release
`At1g08070`	Involved in multiple sites RNA editing events in chloroplasts.	No verified direct reference in this release
`At2g13600`	Pentatricopeptide repeat-containing protein At2g13600.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031329 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0060090 molecular adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT3G02330

ath:AT3G09040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.540

Rank 1 · TkA08G101670 · TK1151

Plastid0.242

Rank 2 · TkA08G101670 · TK1151

Nucleus0.095

Rank 3 · TkA08G101670 · TK1151

Cytoplasm0.044

Rank 4 · TkA08G101670 · TK1151

Peroxisome0.009

Rank 5 · TkA08G101670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01535PPR9-29 aa

PF13812PPR_315-47 aa

PF13812PPR_332-54 aa

PF29571COX2635-47 aa

PF01535PPR39-52 aa

PF20431E_motif50-112 aa

PF01582TIR50-90 aa

PF01535PPR75-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101670	`PF01535`	PPR	9	29	5e-07	30.2
TkA08G101670	`PF13812`	PPR_3	15	47	0.085	13.7
TkA08G101670	`PF13812`	PPR_3	32	54	0.085	13.7
TkA08G101670	`PF29571`	COX26	35	47	0.19	11.9
TkA08G101670	`PF01535`	PPR	39	52	5e-07	30.2
TkA08G101670	`PF20431`	E_motif	50	112	1.1e-21	77.6
TkA08G101670	`PF01582`	TIR	50	90	0.22	12.0
TkA08G101670	`PF01535`	PPR	75	102	5e-07	30.2
TkA08G101670	`PF13812`	PPR_3	80	103	0.085	13.7
TkA08G101670	`PF20430`	Eplus_motif	117	140	0.082	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS83`	Arabidopsis thaliana	sp\|Q9SS83\|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial	47.400%	Swiss-Prot	Medium
`Q9SY02`	Arabidopsis thaliana	sp\|Q9SY02\|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750	46.900%	Swiss-Prot	Medium
`P0C899`	Arabidopsis thaliana	sp\|P0C899\|PP271_ARATH Putative pentatricopeptide repeat-containing protein At3g49142	47.600%	Swiss-Prot	Medium
`Q9LN01`	Arabidopsis thaliana	sp\|Q9LN01\|PPR21_ARATH Pentatricopeptide repeat-containing protein At1g08070, chloroplastic	43.300%	Swiss-Prot	Medium
`Q9SIT7`	Arabidopsis thaliana	sp\|Q9SIT7\|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card