TkA08G100760 | RubberDandelionOmics

Gene overview

TkA08G100760

Reference: TK1151 Chr: Chr08 Coordinates: 26130426-26133138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1629 bp · TkA08G100760|TK1151|cDNA

ATGGGTCGAGTTGTTGTGGCATTTGATGCGACTAAAGATCGAAATGAGCATAAGTTCCAGCATATTATCAATGGCATCGTATCAAGAGTTGACATGCTCAACAGGGGAGATACCATCCTGGTGTTTGGAATTTTGCATAAGGTTTCACATCCCTTTGGTTACCAAATGCATATAGAAGATGCAAACATTCGAGCCATGGAAGAGGATGTTATAAAAAAACTTGATATTTACATCAAAACGCTTCAAACAACCGCTGTAGA...

CDS

Download CDS FASTA

1629 bp · TkA08G100760|TK1151|CDS

ATGGGTCGAGTTGTTGTGGCATTTGATGCGACTAAAGATCGAAATGAGCATAAGTTCCAGCATATTATCAATGGCATCGTATCAAGAGTTGACATGCTCAACAGGGGAGATACCATCCTGGTGTTTGGAATTTTGCATAAGGTTTCACATCCCTTTGGTTACCAAATGCATATAGAAGATGCAAACATTCGAGCCATGGAAGAGGATGTTATAAAAAAACTTGATATTTACATCAAAACGCTTCAAACAACCGCTGTAGA...

Protein

Download Protein FASTA

542 aa · TkA08G100760|TK1151|PROTEIN

MGRVVVAFDATKDRNEHKFQHIINGIVSRVDMLNRGDTILVFGILHKVSHPFGYQMHIEDANIRAMEEDVIKKLDIYIKTLQTTAVDCKVKGVTIEVKITCGTPLKSIVLQETTTSFASWLILDRHLSRDVQYYQSHVICKLAVILDNSTINPIKVNSNTYTDNTEVKIILYKSKYVFLSTPNDEVTPTILNYSNDLEEVPSHFVTKRQKNIGKKTCSDTFILCNVCEITTKLCIKESMRFSYLEIQNATSSFSVKNLIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G100760`
TK1151 ID	TkA08G100760
OH-1004 ID	LXL04_034032
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.200
Protein coverage (%)	TK1151 57.934 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G100760

Location Chr08:26130426-26133138 (+)

Description Similar to CDG1: Serine/threonine-protein kinase CDG1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release
`At3g26940`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032502 developmental process Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23540

ath:AT1G70460

ath:AT3G26940

ath:AT5G38560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.499

Rank 1 · TkA08G100760 · TK1151

Cytoplasm0.361

Rank 2 · TkA08G100760 · TK1151

Nucleus0.276

Rank 3 · TkA08G100760 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA08G100760 · TK1151

Golgi apparatus0.037

Rank 5 · TkA08G100760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr72-109 aa

PF00069Pkinase253-519 aa

PF07714PK_Tyr_Ser-Thr255-521 aa

PF03109ABC1259-286 aa

PF03190Thioredox_DsbH334-358 aa

PF03109ABC1361-400 aa

PF03190Thioredox_DsbH487-518 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G100760	`PF07714`	PK_Tyr_Ser-Thr	72	109	3.9e-35	122.1
TkA08G100760	`PF00069`	Pkinase	253	519	2.7e-39	135.9
TkA08G100760	`PF07714`	PK_Tyr_Ser-Thr	255	521	3.9e-35	122.1
TkA08G100760	`PF03109`	ABC1	259	286	0.025	14.5
TkA08G100760	`PF03190`	Thioredox_DsbH	334	358	0.18	12.5
TkA08G100760	`PF03109`	ABC1	361	400	0.025	14.5
TkA08G100760	`PF03190`	Thioredox_DsbH	487	518	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	44.500%	Swiss-Prot	Medium
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	44.800%	Swiss-Prot	Medium
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	43.800%	Swiss-Prot	Medium
`Q1PEM5`	Arabidopsis thaliana	sp\|Q1PEM5\|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3	44.300%	Swiss-Prot	Medium
`Q9LSE1`	Arabidopsis thaliana	sp\|Q9LSE1\|CDG1_ARATH Serine/threonine-protein kinase CDG1	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card