Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1169 bp · TkA08G097150|TK1151|cDNA
TTCCTTCCATCGATGTCAATTTTATGAGAACAGTTCCTCACCCACTTCTCAAAATTAGTTCTCCCGTCACCCACTTCGTACAACACCAGCGATACACCAGCGATGCCCTAAATCTCACACTAACAGTCGTCGCACCTTCTCCGGTGGCCGGGCTCCGCCAACCAGACACCGTCCTCCACCACCTCCGAGGTTTCGATTGCACACCTTCTTCATCAGTGGCGGGTTCCCTGAGGACTTGTCGCCGTTCTCTCTGTAGTTTC...
327 bp · TkA08G097150|TK1151|CDS
ATGAGAACAGTTCCTCACCCACTTCTCAAAATTAGTTCTCCCGTCACCCACTTCGTACAACACCAGCGATACACCAGCGATGCCCTAAATCTCACACTAACAGTCGTCGCACCTTCTCCGGTGGCCGGGCTCCGCCAACCAGACACCGTCCTCCACCACCTCCGAGGTTTCGATTGCACACCTTCTTCATCAGTGGCGGGTTCCCTGAGGACTTGTCGCCGTTCTCTCTGTAGTTTCGATCATCTTCCTTCTCGTGGCCG...
Protein
Download Protein FASTA108 aa · TkA08G097150|TK1151|PROTEIN
MRTVPHPLLKISSPVTHFVQHQRYTSDALNLTLTVVAPSPVAGLRQPDTVLHHLRGFDCTPSSSVAGSLRTCRRSLCSFDHLPSRGRWFGLNTHRLRSMCRPAADGLG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G097150 |
|---|---|
| TK1151 ID | TkA08G097150 |
| OH-1004 ID | LXL04_015976 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 66.700 |
| Protein coverage (%) | TK1151 95.370 / OH-1004 38.650Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G097150 |
|---|---|
| Location | Chr08:25133478-25136807 (-) |
| Description | Similar to SEC3A: Exocyst complex component SEC3A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006887 exocytosis Biological Process GO:0006893 Golgi to plasma membrane transport Biological Process GO:0043085 positive regulation of catalytic activity Biological Process GO:0048868 pollen tube development Biological Process GO:0060321 acceptance of pollen Biological Process GO:0000145 exocyst Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009524 phragmoplast Cellular Component GO:0070062 extracellular exosome Cellular Component |
| KEGG gene cross-reference | ath:AT1G47550 ath:AT1G47560 ath:AT3G51030 rcu:8266412 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.