LXL04_015976 | RubberDandelionOmics

Gene overview

LXL04_015976

Reference: OH-1004 Chr: Chr03 Coordinates: 101346247-101353031 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_015976|LXL04_015976|OH1004|cDNA

ATGGCGAAATCGAGCGCCGATGATCTGGAGCTCCGGCGAGCCTGCGAAGCTGCAATTGAGGGCACCGACCAGAAGGTTGGTCTGTCGATCCGCGTCGGTAAAAGCCGTGGTGTTTGGGGTAAGGCAGGCAAAATAGGCAAAGGTCAGATGGCTAAGCCTAGGGTTCTTGCAATCTCCACAAAAGAAAAAACTCAAGAAATTAAGGTTTTTCTCCATGTCTTAAAATATTCAAATGGAGGAGTCCTTGAGGTGAAAAAGTT...

CDS

Download CDS FASTA

981 bp · LXL04_015976|LXL04_015976|OH1004|CDS

ATGGCGAAATCGAGCGCCGATGATCTGGAGCTCCGGCGAGCCTGCGAAGCTGCAATTGAGGGCACCGACCAGAAGGTTGGTCTGTCGATCCGCGTCGGTAAAAGCCGTGGTGTTTGGGGTAAGGCAGGCAAAATAGGCAAAGGTCAGATGGCTAAGCCTAGGGTTCTTGCAATCTCCACAAAAGAAAAAACTCAAGAAATTAAGGTTTTTCTCCATGTCTTAAAATATTCAAATGGAGGAGTCCTTGAGGTGAAAAAGTT...

Protein

Download Protein FASTA

326 aa · LXL04_015976|LXL04_015976|OH1004|PROTEIN

MAKSSADDLELRRACEAAIEGTDQKVGLSIRVGKSRGVWGKAGKIGKGQMAKPRVLAISTKEKTQEIKVFLHVLKYSNGGVLEVKKLPEKYEKIDFHSKIWCLKEKLISAAVLSCAATGVVLYLHQRKADLCEVKEKKSTDYGGGVGRTSSSRNFPHPLFKISSPVSHFVQHQRCPINLTLTVVAPSPVAGLRQPDTVLHRLRGFDCTPSSLGVYLQHTVSSHRSDLGIFDLICSTYPVAGSLRTCRRSLRSFDHLPSRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015976`
TK1151 ID	TkA08G097150
OH-1004 ID	LXL04_015976
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	66.700
Protein coverage (%)	TK1151 95.370 / OH-1004 38.650 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015976

Location Chr03:101346247-101353031 (-)

Description Similar to SEC3A: Exocyst complex component SEC3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47550`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	The Arabidopsis exocyst subunit SEC3A is essential for embryo development and accumulates in transient puncta at the plasma membrane.2013 · DOI: 10.1111/nph.12236
`At1g47560`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release
`At3g51030`	Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015976 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0048868 pollen tube development Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0000145 exocyst Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0070062 extracellular exosome Cellular Component

KEGG gene cross-reference

ath:AT1G47550

ath:AT1G47560

ath:AT3G51030

rcu:8266412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.336

Rank 1 · LXL04_015976 · OH-1004

Nucleus0.326

Rank 2 · LXL04_015976 · OH-1004

Mitochondrion0.216

Rank 3 · LXL04_015976 · OH-1004

Cell membrane0.085

Rank 4 · LXL04_015976 · OH-1004

Endoplasmic reticulum0.076

Rank 5 · LXL04_015976 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX85`	Arabidopsis thaliana	Exocyst complex component SEC3A	66.000%	Swiss-Prot	weak database homology
`Q9SX86`	Arabidopsis thaliana	Exocyst complex component SEC3B	70.115%	Swiss-Prot	weak database homology
`P29448`	Arabidopsis thaliana	Thioredoxin H1	48.276%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card