TkA08G096080 | RubberDandelionOmics

Gene overview

TkA08G096080

Reference: TK1151 Chr: Chr08 Coordinates: 24869245-24873169 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · TkA08G096080|TK1151|cDNA

CTGAATTTAATAGGTCGGCAAATTGCAATCGACATACTCTTTACTTTTAGAGAGAGAAGTATAAGAGGTTTAGACCGAGAAACCGCGTGATAAGGACAAGGATCTATCTTTGTTCATAATCACACTCAAAAAACACCAAACAAATTCAAGGTTTGCTTGCTATGCTTTTGTTTGATCTTTCTAAATTTCGTTTTCATCACCAAGGTTTCTTTTCATTCTCCATAAAAACATACAATGACCATGAAGTTTCAAACGCTGTT...

CDS

Download CDS FASTA

1197 bp · TkA08G096080|TK1151|CDS

ATGTCATTTCGAAGCATAGTTCGCGATATAAGAGATGGCATTGGGAACTTATCTAGACGGGGATTTGAAAGAAGTAAATCACACAGTTTTGTTCATGAATTGGATAACCACTTGGATGTTGTAACCAATAGCGGTTGGGAGGGTCTCCCTCCCGAATTGCTTCGTGATGTGATTAAGAGATTGGAAGCAAGCGAAAGTACATGGCCTTCTCGCAAGCATGTGGTTGCATGTGCCTCAGTCTGTAGATCTTGGAGGGAAAT...

Protein

Download Protein FASTA

398 aa · TkA08G096080|TK1151|PROTEIN

MSFRSIVRDIRDGIGNLSRRGFERSKSHSFVHELDNHLDVVTNSGWEGLPPELLRDVIKRLEASESTWPSRKHVVACASVCRSWREMCKEIVSSLENSGKLTFPLSLKQPGPRDTTIQCFIKRDTSNSTYYLYLCLSSALVVENGKFLLSAKRSRKSTCTEYVISLDADNISRSNHGYIGKVRSNFLGTKFIIYDSQPPHNTANVVPPGRLGSSRRFSRRVSPKVPSGSFNIAQIAYELNVLGTRGPRRMNCIMHSIPMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G096080`
TK1151 ID	TkA08G096080
OH-1004 ID	LXL04_031234
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 94.472 / OH-1004 95.431 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G096080

Location Chr08:24869245-24873169 (-)

Description Similar to TULP14: Tubby-like F-box protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76900`	Tubby-like F-box protein 1.	No verified direct reference in this release
`At1g25280`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0163400`	Tubby-like F-box protein 14.	No verified direct reference in this release
`Os05g0437900`	Tubby-like F-box protein 8.	No verified direct reference in this release
`Os11g0163600`	Tubby-like F-box protein 13.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031234 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G76900

dosa:Os04g0687900

dosa:Os05g0437900

dosa:Os11g0163600

dosa:Os12g0163400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.465

Rank 1 · TkA08G096080 · TK1151

Nucleus0.372

Rank 2 · TkA08G096080 · TK1151

Cell membrane0.311

Rank 3 · TkA08G096080 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA08G096080 · TK1151

Plastid0.043

Rank 5 · TkA08G096080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box2-9 aa

PF12937F-box-like46-89 aa

PF00646F-box46-89 aa

PF01167Tub107-362 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G096080	`PF00646`	F-box	2	9	2.1e-05	24.9
TkA08G096080	`PF12937`	F-box-like	46	89	1.3e-06	28.8
TkA08G096080	`PF00646`	F-box	46	89	2.1e-05	24.9
TkA08G096080	`PF01167`	Tub	107	362	2.4e-77	260.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZP59`	Arabidopsis thaliana	sp\|Q9ZP59\|TLP1_ARATH Tubby-like F-box protein 1	65.400%	Swiss-Prot	High
`Q9FRH7`	Arabidopsis thaliana	sp\|Q9FRH7\|TLP10_ARATH Tubby-like F-box protein 10	64.900%	Swiss-Prot	High
`Q2QXB2`	Oryza sativa subsp. japonica	sp\|Q2QXB2\|TLP14_ORYSJ Tubby-like F-box protein 14	65.100%	Swiss-Prot	High
`Q75HX5`	Oryza sativa subsp. japonica	sp\|Q75HX5\|TLP8_ORYSJ Tubby-like F-box protein 8	65.900%	Swiss-Prot	High
`Q53PP5`	Oryza sativa subsp. japonica	sp\|Q53PP5\|TLP13_ORYSJ Tubby-like F-box protein 13	62.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card