TkA08G088240 | RubberDandelionOmics

Gene overview

TkA08G088240

Reference: TK1151 Chr: Chr08 Coordinates: 22848338-22849822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · TkA08G088240|TK1151|cDNA

ATGGGTTACCTCTCTTGTAATGCCGAATCCGCCATTTCCACCTGCGATTCTTACAATTTGAATTTGTCCAGGAAGAAATCGCCTTCCAATCCACATAATAAGCACTTTAAGATCAGGGATTTCTGTTTTTCTGATCTCGAAGCGGCTACCACGGGATTCTCACAGACCAATTTCCTTGGGAAAGGAAGCCATGGTTCTGTCTATAGAGCTATTCTTGACGGTGGCGCTTTGATTGCGGCCGTTAAACGAACCACCAATCA...

CDS

Download CDS FASTA

1410 bp · TkA08G088240|TK1151|CDS

ATGGGTTACCTCTCTTGTAATGCCGAATCCGCCATTTCCACCTGCGATTCTTACAATTTGAATTTGTCCAGGAAGAAATCGCCTTCCAATCCACATAATAAGCACTTTAAGATCAGGGATTTCTGTTTTTCTGATCTCGAAGCGGCTACCACGGGATTCTCACAGACCAATTTCCTTGGGAAAGGAAGCCATGGTTCTGTCTATAGAGCTATTCTTGACGGTGGCGCTTTGATTGCGGCCGTTAAACGAACCACCAATCA...

Protein

Download Protein FASTA

469 aa · TkA08G088240|TK1151|PROTEIN

MGYLSCNAESAISTCDSYNLNLSRKKSPSNPHNKHFKIRDFCFSDLEAATTGFSQTNFLGKGSHGSVYRAILDGGALIAAVKRTTNHHSPEKSIASPAENEIETLSRVRSPRLVNLLGFGSDPVDGRKLIVVEYMPNGSLYDLLHKNDAKTPGLARRVRIAVQVAKAVHHLHTSNPPVIHRDIKSSNVLFDGKWNARLGDFGLALRGNVEDVKVRCTPPAGTLGYLDPCYLAPGDLSSKSDVFSFGILLLEIFSGRNAID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G088240`
TK1151 ID	TkA08G088240
OH-1004 ID	LXL04_031122
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G088240

Location Chr08:22848338-22849822 (+)

Description Similar to At1g28390: Serine/threonine-protein kinase-like protein At1g28390

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28390`	Serine/threonine-protein kinase-like protein At1g28390.	No verified direct reference in this release
`At3g51990`	Serine/threonine-protein kinase-like protein At3g51990.	No verified direct reference in this release
`At5g23170`	Serine/threonine-protein kinase-like protein At5g23170.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031122 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0048439 flower morphogenesis Biological Process

GO:0048829 root cap development Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0099402 plant organ development Biological Process

KEGG gene cross-reference

ath:AT1G28390

ath:AT3G51990

ath:AT3G59420

ath:AT5G23170

dosa:Os03g0637800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.631

Rank 1 · TkA08G088240 · TK1151

Nucleus0.270

Rank 2 · TkA08G088240 · TK1151

Cytoplasm0.238

Rank 3 · TkA08G088240 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA08G088240 · TK1151

Plastid0.029

Rank 5 · TkA08G088240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase54-324 aa

PF07714PK_Tyr_Ser-Thr56-326 aa

PF01636APH60-171 aa

PF01636APH171-194 aa

PF22841CATSPERE_NTD1251-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G088240	`PF00069`	Pkinase	54	324	4.7e-37	128.5
TkA08G088240	`PF07714`	PK_Tyr_Ser-Thr	56	326	6.3e-36	124.7
TkA08G088240	`PF01636`	APH	60	171	0.19	12.2
TkA08G088240	`PF01636`	APH	171	194	0.19	12.2
TkA08G088240	`PF22841`	CATSPERE_NTD1	251	275	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGN7`	Arabidopsis thaliana	sp\|Q9SGN7\|CCR12_ARATH Serine/threonine-protein kinase-like protein At1g28390	53.900%	Swiss-Prot	High
`Q9SV05`	Arabidopsis thaliana	sp\|Q9SV05\|CCR35_ARATH Serine/threonine-protein kinase-like protein At3g51990	48.600%	Swiss-Prot	Medium
`Q9FMY3`	Arabidopsis thaliana	sp\|Q9FMY3\|STPKL_ARATH Serine/threonine-protein kinase-like protein At5g23170	42.400%	Swiss-Prot	Medium
`Q75J39`	Oryza sativa subsp. japonica	sp\|Q75J39\|CKI4_ORYSJ Serine/threonine-protein kinase-like protein CR4	43.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card