TkA08G087890 | RubberDandelionOmics

Gene overview

TkA08G087890

Reference: TK1151 Chr: Chr08 Coordinates: 22784485-22786205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

756 bp · TkA08G087890|TK1151|cDNA

AAACGTAAAAAAGCCCAATCCTTGTCCCAATATATATCGTACCGGCTACAAGAACAACGTCCCTCTGCTGTCTCTCAGTCTCTCTCCGGCGTCCAAACAGATCATACTTTTCGCGTAATACTGCTTCAGTCTCTTTTCGACATCGAAACATGAGTCGACCAATGGAGGAAGACGCACCAACTAAAAACGAGGAAGAGGAGTTCAACACGGGCCCCCTCTCTGTCTTGATGATGAGTGTCAAAAACAATACACAGGTTCTT...

CDS

Download CDS FASTA

327 bp · TkA08G087890|TK1151|CDS

ATGAGTCGACCAATGGAGGAAGACGCACCAACTAAAAACGAGGAAGAGGAGTTCAACACGGGCCCCCTCTCTGTCTTGATGATGAGTGTCAAAAACAATACACAGGTTCTTATTAATTGCAGGAATAATAAGAAGCTTCTAGGCCGTGTTAGGGCGTTTGATAGACACTGCAACATGGTGCTTGAAAATGTTAGAGAGATGTGGACTGAGGTACCCAAAACAGGAAAAGGCAAGAAGAAAGCTCTTCCGATTAACAAAGA...

Protein

Download Protein FASTA

108 aa · TkA08G087890|TK1151|PROTEIN

MSRPMEEDAPTKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPINKDRFISKMFLRGDSVIIVLRNPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087890`
TK1151 ID	TkA08G087890
OH-1004 ID	LXL04_037067
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 96.296 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G087890`
Location	Chr08:22784485-22786205 (+)
Description	Similar to SmD2: Probable small nuclear ribonucleoprotein Sm D2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037067` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000245 spliceosomal complex assembly Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0008380 RNA splicing Biological Process GO:0036261 7-methylguanosine cap hypermethylation Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	cel:CELE_C52E4.3 ddi:DDB_G0285395 dme:Dmel_CG1249 hsa:6633 mmu:107686 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909

Rank 1 · TkA08G087890 · TK1151

Cytoplasm0.232

Rank 2 · TkA08G087890 · TK1151

Mitochondrion0.023

Rank 3 · TkA08G087890 · TK1151

Cell membrane0.018

Rank 4 · TkA08G087890 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA08G087890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17209Hfq27-60 aa

PF01423LSM29-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087890	`PF17209`	Hfq	27	60	0.027	14.8
TkA08G087890	`PF01423`	LSM	29	103	5.3e-18	65.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card