Gene Card
Gene overview
cDNA / CDS / Protein Sequences
325 bp · LXL04_037067|LXL04_037067|OH1004|cDNA
TCGACCAATGGAGGAAGATGGGCAACAGACCAAGAATGAAGAAGAGGAGTTCAACACTGGGCCTCTTTCAGTCTTGATGATGAGTGTAAAAAACAACACGCAGGTGCTCATTAACTGCAGGAACAATAAAAAGCTTCTTGGACGTGTGAGAGCCTTTGATAGACACTGTAACATGGTGTTAGAAAATGTCAGAGAGATGTGGACTGAGGTACCAAAAACAGGAAAAGGCAAGAAAAAAGCACTTCCAATAAACAAAGACA...
318 bp · LXL04_037067|LXL04_037067|OH1004|CDS
ATGGAGGAAGATGGGCAACAGACCAAGAATGAAGAAGAGGAGTTCAACACTGGGCCTCTTTCAGTCTTGATGATGAGTGTAAAAAACAACACGCAGGTGCTCATTAACTGCAGGAACAATAAAAAGCTTCTTGGACGTGTGAGAGCCTTTGATAGACACTGTAACATGGTGTTAGAAAATGTCAGAGAGATGTGGACTGAGGTACCAAAAACAGGAAAAGGCAAGAAAAAAGCACTTCCAATAAACAAAGACAGATTCAT...
Protein
Download Protein FASTA105 aa · LXL04_037067|LXL04_037067|OH1004|PROTEIN
MEEDGQQTKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEVPKTGKGKKKALPINKDRFISKMFLRGDSVIIVLRNPK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037067 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037067 |
|---|---|
| Location | Chr08:52531440-52532104 (+) |
| Description | Similar to SmD2: Probable small nuclear ribonucleoprotein Sm D2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000245 spliceosomal complex assembly Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0008380 RNA splicing Biological Process GO:0036261 7-methylguanosine cap hypermethylation Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:0005634 nucleus Cellular Component |
| KEGG gene cross-reference | cel:CELE_C52E4.3 ddi:DDB_G0285395 dme:Dmel_CG1249 hsa:6633 mmu:107686 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01423.29LSM26-100 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037067 | PF01423.29 | LSM | 26 | 100 | 4.7e-18 | 65.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.