Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4130 bp · TkA08G087770|TK1151|cDNA
CTCTATAGTCTGTATCCAGCCACATCAGTGCCCTCGCCTAAACCTGCACTTCCTACTTCTTTCCGCATCGCAACCATCCTACCCCCACTCCGTTCTTCATTATAAATACCACATAAACACTCAAAAGCCCTTAAACAAATAATTTTCCCCTTTCAATCATTACATTTTCTACAGGATAATACGTAGAAATTAGAGATTTAAAATACACCATTTCATCAATTCTCTGTAACAATCGTCTGCGAAACCAACTCCGAACCCAA...
3582 bp · TkA08G087770|TK1151|CDS
ATGGTTGAAACAAGGCGCACCTCCTCTTCTTCCAAACGCACACTCTCGTCACCATGTTCTTCTCCACAGTCAGGCAAAAGATCTAAGGCTGCAGAAGCGGCATCGTCATCTACTACAGGCTTACCTGAACAGCCAATTGATGCGGAGGTGAAGAAATCAGGTGCGTGCGAGTCTCAAGAGCAAGAGTTCGGATCGGCTGATCTTTCTAAGAAAGAGATCGATGGTTGTGGTGACGTTGTGGTTGCTGATGCTCTAGATGA...
Protein
Download Protein FASTA1193 aa · TkA08G087770|TK1151|PROTEIN
MVETRRTSSSSKRTLSSPCSSPQSGKRSKAAEAASSSTTGLPEQPIDAEVKKSGACESQEQEFGSADLSKKEIDGCGDVVVADALDEKCPVIQVNGEPLVSPMSLGDSLIEVETTKANGGSAVLNIPKKRQSKPNVGVAWGKLLSQSSQIPHVVMDRSLFTVGQSHQCDLCIGDPSISKSLCTIRFIESERGGSSITLLEITGGKGVVKVNGKIYPSKSTVPLKAGDEVIFSSSRGHAYIFQRLLNDTNVTPSLSLLKAH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G087770 |
|---|---|
| TK1151 ID | TkA08G087770 |
| OH-1004 ID | LXL04_018882 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G087770 |
|---|---|
| Location | Chr08:22738208-22746789 (+) |
| Description | Similar to atad1a: ATPase family AAA domain-containing protein 1-A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002092 positive regulation of receptor internalization Biological Process GO:0006626 protein targeting to mitochondrion Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0034214 protein hexamerization Biological Process GO:0045047 protein targeting to ER Biological Process GO:0140570 extraction of mislocalized protein from mitochondrial outer membrane Biological Process GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0140567 membrane protein dislocase activity Molecular Function |
| KEGG gene cross-reference | bta:506045 mmu:67979 rno:309532 sce:YGR028W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24883NPHP3_N79-87 aaPF16697Yop-YscD_cpl159-226 aaPF00498FHA161-231 aaPF13401AAA_22403-459 aaPF13481AAA_25442-480 aaPF18129SH3_12568-613 aaPF00004AAA614-662 aaPF13173AAA_14636-692 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G087770 | PF24883 | NPHP3_N | 79 | 87 | 0.16 | 12.9 |
| TkA08G087770 | PF16697 | Yop-YscD_cpl | 159 | 226 | 0.12 | 13.5 |
| TkA08G087770 | PF00498 | FHA | 161 | 231 | 3.7e-05 | 24.8 |
| TkA08G087770 | PF13401 | AAA_22 | 403 | 459 | 0.00044 | 21.3 |
| TkA08G087770 | PF13481 | AAA_25 | 442 | 480 | 0.0089 | 16.4 |
| TkA08G087770 | PF18129 | SH3_12 | 568 | 613 | 0.00078 | 20.1 |
| TkA08G087770 | PF00004 | AAA | 614 | 662 | 2.9e-40 | 138.5 |
| TkA08G087770 | PF13173 | AAA_14 | 636 | 692 | 0.00032 | 21.4 |
| TkA08G087770 | PF07724 | AAA_2 | 644 | 657 | 0.025 | 15.3 |
| TkA08G087770 | PF13479 | AAA_24 | 669 | 695 | 0.028 | 14.8 |
| TkA08G087770 | PF01057 | Parvo_NS1 | 737 | 787 | 0.48 | 10.1 |
| TkA08G087770 | PF24933 | DUF7751 | 790 | 849 | 3e-22 | 79.5 |
| TkA08G087770 | PF13173 | AAA_14 | 867 | 908 | 0.00032 | 21.4 |
| TkA08G087770 | PF02367 | TsaE | 922 | 953 | 0.24 | 12.1 |
| TkA08G087770 | PF12775 | AAA_7 | 923 | 964 | 0.034 | 14.4 |
| TkA08G087770 | PF05673 | DUF815 | 924 | 954 | 0.21 | 11.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.