RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G085010
Reference: TK1151 Chr: Chr08 Coordinates: 21889785-21898421 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2637 bp · TkA08G085010|TK1151|cDNA

TTTCAATAAGCATTCAATTCTGTCCCATTTTTCATGTTATATGATTCCAGTGTGTTTCGCTCTCCTGTAGTGCTTAAATGTCAGGTAATTCACCGGAGGGGACGACCGCCTCCAGTCGCCGGAGTACCGTCCGCGTCGTAGTTGTCGGTGATCACGCGACTGGTAAATCAAGCCTAATCGCCGCAGCTGCCTCCGATATTTTTCCCGAAAATGTTCCACTTGTTCTTCCTATCACTCTTCTTCCTGCCGATTACTTCCCC...

CDS

Download CDS FASTA

1950 bp · TkA08G085010|TK1151|CDS

ATGTCAGGTAATTCACCGGAGGGGACGACCGCCTCCAGTCGCCGGAGTACCGTCCGCGTCGTAGTTGTCGGTGATCACGCGACTGGTAAATCAAGCCTAATCGCCGCAGCTGCCTCCGATATTTTTCCCGAAAATGTTCCACTTGTTCTTCCTATCACTCTTCTTCCTGCCGATTACTTCCCCGATGGCATTCCCGTCACAATCATTGATACTCCATCCAGTTTGGAAGGTAAAGCTAAGGTAGAGAAAGAACTGAAACG...

Protein

Download Protein FASTA

649 aa · TkA08G085010|TK1151|PROTEIN

MSGNSPEGTTASSRRSTVRVVVVGDHATGKSSLIAAAASDIFPENVPLVLPITLLPADYFPDGIPVTIIDTPSSLEGKAKVEKELKRADAIVLTYACDQPETLTRLQNFWLPEIRRLKVKIPVIVVGCKLDLRDEHYPINLELVMGPIMQQFREIETCIECSAANLVQVVEVFYYAQKAVLHPTAPLFDQESQTLQPRCIRALKRIFLLCDQDMDSALNDHELNEFQVKCFNAPLQPSEIVDVKRVVREKIPDGVNRLGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G085010
TK1151 IDTkA08G085010
OH-1004 IDLXL04_018826
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G085010
LocationChr08:21889785-21898421 (-)
DescriptionSimilar to MIRO2: Mitochondrial Rho GTPase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g63150 Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.
Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
At5g27540 Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.
EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756
MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5
Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
At3g05310 Mitochondrial GTPase that may be involved in mitochondrion development. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018826 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000001 mitochondrion inheritance Biological Process
GO:0007005 mitochondrion organization Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0010821 regulation of mitochondrion organization Biological Process
GO:0015886 heme transport Biological Process
GO:0055091 phospholipid homeostasis Biological Process
GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005741 mitochondrial outer membrane Cellular Component
GO:0009536 plastid Cellular Component
KEGG gene cross-reference
ath:AT3G05310
ath:AT3G63150
ath:AT5G27540
cnb:CNBF0860
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.346
Rank 1 · TkA08G085010 · TK1151
Cell membrane0.220
Rank 2 · TkA08G085010 · TK1151
Mitochondrion0.206
Rank 3 · TkA08G085010 · TK1151
Nucleus0.169
Rank 4 · TkA08G085010 · TK1151
Golgi apparatus0.113
Rank 5 · TkA08G085010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13191AAA_1617-41 aa
PF05621TniB17-35 aa
PF09439SRPRB18-84 aa
PF01637ATPase_218-38 aa
PF13479AAA_2418-45 aa
PF00071Ras19-180 aa
PF08477Roc19-131 aa
PF01926MMR_HSR119-125 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G085010PF13191AAA_1617410.004218.3
TkA08G085010PF05621TniB17350.2611.4
TkA08G085010PF09439SRPRB18840.001119.1
TkA08G085010PF01637ATPase_218380.1113.0
TkA08G085010PF13479AAA_2418450.1412.6
TkA08G085010PF00071Ras191803.9e-2072.8
TkA08G085010PF08477Roc191312.4e-1041.4
TkA08G085010PF01926MMR_HSR1191253.6e-0834.2
TkA08G085010PF13555AAA_2919390.01216.1
TkA08G085010PF00350Dynamin_N20362.4e-0525.1
TkA08G085010PF19993DO-GTPase220370.2811.5
TkA08G085010PF13514AAA_2721380.311.4
TkA08G085010PF00350Dynamin_N65992.4e-0525.1
TkA08G085010PF19993DO-GTPase279990.2811.5
TkA08G085010PF05621TniB1131280.2611.4
TkA08G085010PF10591SPARC_Ca_bdg1862280.2112.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4J0W4Arabidopsis thalianasp|F4J0W4|MIRO2_ARATH Mitochondrial Rho GTPase 260.100%Swiss-ProtHigh
Q8RXF8Arabidopsis thalianasp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 162.000%Swiss-ProtHigh
Q9MA88Arabidopsis thalianasp|Q9MA88|MIRO3_ARATH Mitochondrial Rho GTPase 350.100%Swiss-ProtHigh

JBrowse

View in Genome Browser