LXL04_018826 | RubberDandelionOmics

Gene overview

LXL04_018826

Reference: OH-1004 Chr: Chr04 Coordinates: 18784123-18791084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_018826|LXL04_018826|OH1004|cDNA

ATGTCAGGTAATTCACCGGAGGGGACGACCGCCTCCAGTCGCCGGAGTACCGTCCGCGTCGTAGTTGTCGGTGATCACGCGACTGGTAAATCAAGCCTAATCGCCGCAGCTGCCTCCGATATTTTTCCCGAAAATGTTCCACTTGTTCTTCCTATCACTCTTCTTCCTGCCGATTACTTCCCCGATGGCATTCCCGTCACAATCATTGATACTCCATCCAGTTTGGAAGGTAAAGCTAAGGTAGAGAAAGAACTGAAACG...

CDS

Download CDS FASTA

1950 bp · LXL04_018826|LXL04_018826|OH1004|CDS

ATGTCAGGTAATTCACCGGAGGGGACGACCGCCTCCAGTCGCCGGAGTACCGTCCGCGTCGTAGTTGTCGGTGATCACGCGACTGGTAAATCAAGCCTAATCGCCGCAGCTGCCTCCGATATTTTTCCCGAAAATGTTCCACTTGTTCTTCCTATCACTCTTCTTCCTGCCGATTACTTCCCCGATGGCATTCCCGTCACAATCATTGATACTCCATCCAGTTTGGAAGGTAAAGCTAAGGTAGAGAAAGAACTGAAACG...

Protein

Download Protein FASTA

649 aa · LXL04_018826|LXL04_018826|OH1004|PROTEIN

MSGNSPEGTTASSRRSTVRVVVVGDHATGKSSLIAAAASDIFPENVPLVLPITLLPADYFPDGIPVTIIDTPSSLEGKAKVEKELKRADAIVLTYACDQPETLTRLQNFWLPEIRRLKVKIPVIVVGCKLDLRDEHYPINLELVMGPIMQQFREIETCIECSAANLVQVVEVFYYAQKAVLHPTAPLFDQESQTLQPRCIRALKRIFLLCDQDMDSALNDHELNEFQVKCFNAPLQPSEIVDVKRVVREKIPDGVNRLGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018826`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018826

Location Chr04:18784123-18791084 (-)

Description Similar to MIRO2: Mitochondrial Rho GTPase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63150`	Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.	Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At5g27540`	Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.	EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756 MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5 Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
`At3g05310`	Mitochondrial GTPase that may be involved in mitochondrion development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018826 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000001 mitochondrion inheritance Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0015886 heme transport Biological Process

GO:0055091 phospholipid homeostasis Biological Process

GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G05310

ath:AT3G63150

ath:AT5G27540

cnb:CNBF0860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.349

Rank 1 · LXL04_018826 · OH-1004

Cell membrane0.223

Rank 2 · LXL04_018826 · OH-1004

Mitochondrion0.202

Rank 3 · LXL04_018826 · OH-1004

Nucleus0.170

Rank 4 · LXL04_018826 · OH-1004

Golgi apparatus0.114

Rank 5 · LXL04_018826 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071.29Ras19-180 aa

PF08477.20Roc19-131 aa

PF01926.30MMR_HSR119-125 aa

PF08356.19EF_assoc_2234-318 aa

PF08355.18EF_assoc_1355-422 aa

PF00071.29Ras432-592 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018826	`PF00071.29`	Ras	19	180	4e-20	72.7
LXL04_018826	`PF08477.20`	Roc	19	131	2.4e-10	41.4
LXL04_018826	`PF01926.30`	MMR_HSR1	19	125	3.2e-08	34.4
LXL04_018826	`PF08356.19`	EF_assoc_2	234	318	2.9e-29	101.6
LXL04_018826	`PF08355.18`	EF_assoc_1	355	422	1.7e-20	73.1
LXL04_018826	`PF00071.29`	Ras	432	592	4e-20	72.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J0W4`	Arabidopsis thaliana	Mitochondrial Rho GTPase 2	60.031%	Swiss-Prot	strong database homology
`Q8RXF8`	Arabidopsis thaliana	Mitochondrial Rho GTPase 1	62.025%	Swiss-Prot	strong database homology
`Q9MA88`	Arabidopsis thaliana	Mitochondrial Rho GTPase 3	50.078%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card