TkA08G075270 | RubberDandelionOmics

Gene overview

TkA08G075270

Reference: TK1151 Chr: Chr08 Coordinates: 19336783-19343413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1000 bp · TkA08G075270|TK1151|cDNA

TTGAGATCGTCTCAATCAATCTCAAGTCGCCTGAGATTTGTTCATATAAAAAACTTTCTGGTTTCGATTTCCCAAGAGAAAAGATGAACGATGTCGATGTCTCGAAACAGATACAACAGATGGTCGCATTCATTCGGCAAGAAGCCGAAGAGAAAGCTAACGAGATCTCTGTCTCATCTGAAGAGGAATTTAACATCGAGAAAATGCAAATAGTGGACACCGAGAAGAAGAAAATCAAACAGGACTACGAACGCAAGACA...

CDS

Download CDS FASTA

681 bp · TkA08G075270|TK1151|CDS

ATGAACGATGTCGATGTCTCGAAACAGATACAACAGATGGTCGCATTCATTCGGCAAGAAGCCGAAGAGAAAGCTAACGAGATCTCTGTCTCATCTGAAGAGGAATTTAACATCGAGAAAATGCAAATAGTGGACACCGAGAAGAAGAAAATCAAACAGGACTACGAACGCAAGACAAAACAAGTGGATGTTAAAAAGAAAATTGAATACTCAATGCAACTAAATGCATCTCGTATCAAAGTTCTTCAAGCACAAGATGA...

Protein

Download Protein FASTA

226 aa · TkA08G075270|TK1151|PROTEIN

MNDVDVSKQIQQMVAFIRQEAEEKANEISVSSEEEFNIEKMQIVDTEKKKIKQDYERKTKQVDVKKKIEYSMQLNASRIKVLQAQDDLVIGMKNAAAKELLNVSHNKKTYRNLMKSLIVQGLQKLNERAVLLRCREVDLSLVESTLEDAKRDYFSKAKVDVRIELDKKVYLPPPPSNSDPNRLSCCGGVVLASIDGKIVFENTLDARLDLAFRNKLPEIRKTLFKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G075270`
TK1151 ID	TkA08G075270
OH-1004 ID	LXL04_018642
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.900
Protein coverage (%)	TK1151 96.903 / OH-1004 45.127 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G075270

Location Chr08:19336783-19343413 (+)

Description Similar to VHA-E1: V-type proton ATPase subunit E1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11150`	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function.	Arabidopsis vacuolar H-ATPase subunit E isoform 1 is required for Golgi organization and vacuole function in embryogenesis.2005 · DOI: 10.1111/j.1365-313x.2004.02283.x
`At1g64200`	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function.	No verified direct reference in this release
`At3g08560`	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018642 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007030 Golgi organization Biological Process

GO:0009409 response to cold Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G64200

ath:AT4G11150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553

Rank 1 · TkA08G075270 · TK1151

Nucleus0.254

Rank 2 · TkA08G075270 · TK1151

Mitochondrion0.147

Rank 3 · TkA08G075270 · TK1151

Cell membrane0.136

Rank 4 · TkA08G075270 · TK1151

Lysosome / Vacuole0.088

Rank 5 · TkA08G075270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12054DUF35356-86 aa

PF07377DUF149311-63 aa

PF01991vATP-synt_E16-224 aa

PF18981InlK_D319-85 aa

PF19172DUF585427-107 aa

PF16556IL17R_fnIII_D170-123 aa

PF19172DUF5854116-134 aa

PF07377DUF1493137-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G075270	`PF12054`	DUF3535	6	86	0.046	13.7
TkA08G075270	`PF07377`	DUF1493	11	63	0.025	16.0
TkA08G075270	`PF01991`	vATP-synt_E	16	224	2.9e-64	216.9
TkA08G075270	`PF18981`	InlK_D3	19	85	0.081	13.7
TkA08G075270	`PF19172`	DUF5854	27	107	2.0	8.9
TkA08G075270	`PF16556`	IL17R_fnIII_D1	70	123	0.11	13.2
TkA08G075270	`PF19172`	DUF5854	116	134	2.0	8.9
TkA08G075270	`PF07377`	DUF1493	137	175	0.025	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39258`	Arabidopsis thaliana	sp\|Q39258\|VATE1_ARATH V-type proton ATPase subunit E1	70.700%	Swiss-Prot	High
`P0CAN7`	Arabidopsis thaliana	sp\|P0CAN7\|VATE3_ARATH V-type proton ATPase subunit E3	69.700%	Swiss-Prot	High
`Q9C9Z8`	Arabidopsis thaliana	sp\|Q9C9Z8\|VATE2_ARATH V-type proton ATPase subunit E2	65.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card