RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G072120
Reference: TK1151 Chr: Chr08 Coordinates: 18584846-18586000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1068 bp · TkA08G072120|TK1151|cDNA

ATAAAGCAAACACCAAATTCTTTTATTATCGGTGGGCATAGAATATGTTCCCAATCCCCATAACAAACATTCTTCTATCATCTTCCATCATCTTCATTCTTCCCCAACTTTCCAAATTCCGCCATGGCAGTAAGCAACAACATAATAGCCACCATAAACTTCATAGCACTCATATGTTCAATCCCAATAATCGTCACCGGCATCTGGCTCGCTTCCAAACCCGACAACCAATGCATCCGCTCCCTCCCCTGGCCGATCAT...

CDS

Download CDS FASTA

786 bp · TkA08G072120|TK1151|CDS

ATGGCAGTAAGCAACAACATAATAGCCACCATAAACTTCATAGCACTCATATGTTCAATCCCAATAATCGTCACCGGCATCTGGCTCGCTTCCAAACCCGACAACCAATGCATCCGCTCCCTCCCCTGGCCGATCATCTTCCTCGGGGTTCTCTTCCTCCTCCTCTCCCTCACAGGCTTCATCGGAGCTCACTGGAACAACCAGGGGTTATTGTCCTTTTACCTCTTCTGCAACGCCGCACTCATAGTCACCGGAATCAT...

Protein

Download Protein FASTA

261 aa · TkA08G072120|TK1151|PROTEIN

MAVSNNIIATINFIALICSIPIIVTGIWLASKPDNQCIRSLPWPIIFLGVLFLLLSLTGFIGAHWNNQGLLSFYLFCNAALIVTGIILLILAFIVVHPSGEYSVPGREYDEYRYMGYSEWLREHITDPENWRSIRACLASSSICTKMVRDSYSAPEFFAARISSLQSGCCKPPTVCGYQYVNPITWINPTNPVGDVDCMIWNNDPNQLCYNCDSCKAGVLGNLRKEWKEANVILIVAVVALVCLYLIAFNAYKNAQGGPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G072120
TK1151 IDTkA08G072120
OH-1004 IDLXL04_018612
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G072120
LocationChr08:18584846-18586000 (-)
DescriptionSimilar to TET2: Tetraspanin-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g19580 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At5g46700 Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization, as well as cell differentiation.
Tornado1 and tornado2 are required for the specification of radial and circumferential pattern in the Arabidopsis root.2000 · DOI: 10.1242/dev.127.15.3385
The ekeko mutant demonstrates a role for tetraspanin-like protein in plant development.2003 · DOI: 10.1016/j.bbrc.2003.09.122
The TORNADO1 and TORNADO2 genes function in several patterning processes during early leaf development in Arabidopsis thaliana.2006 · DOI: 10.1105/tpc.105.040568
Mutations in the TORNADO2 gene affect cellular decisions in the peripheral zone of the shoot apical meristem of Arabidopsis thaliana.2007 · DOI: 10.1007/s11103-006-9105-z
Arabidopsis WIH1 and WIH2 genes act in the transition from somatic to reproductive cell fate.2011 · DOI: 10.1016/j.cub.2011.05.015
At5g60220 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At3g45600 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At2g23810 May be involved in the regulation of cell differentiation. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018612 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009554 megasporogenesis Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009933 meristem structural organization Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0009956 radial pattern formation Biological Process
GO:0010015 root morphogenesis Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT2G19580
ath:AT3G45600
ath:AT4G28050
ath:AT4G30430
ath:AT5G46700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.726
Rank 1 · TkA08G072120 · TK1151
Lysosome / Vacuole0.130
Rank 2 · TkA08G072120 · TK1151
Cytoplasm0.101
Rank 3 · TkA08G072120 · TK1151
Endoplasmic reticulum0.081
Rank 4 · TkA08G072120 · TK1151
Golgi apparatus0.039
Rank 5 · TkA08G072120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335Tetraspanin6-247 aa
PF22954DUF70276-100 aa
PF18967PycTM7-57 aa
PF20088DUF64808-27 aa
PF20794bPH_710-58 aa
PF17343DUF537313-100 aa
PF01757Acyl_transf_314-95 aa
PF11190DUF297615-32 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G072120PF00335Tetraspanin62471.4e-30107.4
TkA08G072120PF22954DUF702761000.4711.1
TkA08G072120PF18967PycTM7570.8710.1
TkA08G072120PF20088DUF64808270.1712.5
TkA08G072120PF20794bPH_710584.87.5
TkA08G072120PF17343DUF5373131000.1312.5
TkA08G072120PF01757Acyl_transf_314950.004117.0
TkA08G072120PF11190DUF297615320.04214.6
TkA08G072120PF17555TssN19910.2711.4
TkA08G072120PF20088DUF648044550.1712.5
TkA08G072120PF20990DUF2207_C481220.06713.6
TkA08G072120PF18967PycTM481430.8710.1
TkA08G072120PF11190DUF297673970.04214.6
TkA08G072120PF20794bPH_779934.87.5
TkA08G072120PF20088DUF648083950.1712.5
TkA08G072120PF01757Acyl_transf_32202510.004117.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZUN5Arabidopsis thalianasp|Q9ZUN5|TET2_ARATH Tetraspanin-254.500%Swiss-ProtHigh
Q9FIQ5Arabidopsis thalianasp|Q9FIQ5|TRN2_ARATH Protein TORNADO 241.400%Swiss-ProtMedium
Q9LSS4Arabidopsis thalianasp|Q9LSS4|TET4_ARATH Tetraspanin-443.800%Swiss-ProtMedium
Q9M1E7Arabidopsis thalianasp|Q9M1E7|TET3_ARATH Tetraspanin-340.800%Swiss-ProtMedium
Q8S8Q6Arabidopsis thalianasp|Q8S8Q6|TET8_ARATH Tetraspanin-836.200%Swiss-ProtMedium

JBrowse

View in Genome Browser