LXL04_018612 | RubberDandelionOmics

Gene overview

LXL04_018612

Reference: OH-1004 Chr: Chr04 Coordinates: 15579741-15580618 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

791 bp · LXL04_018612|LXL04_018612|OH1004|cDNA

ATGGCAGTAAGCAACAACATAATAGCCACCATAAACTTCATAGCACTCATATGTTCAATCCCAATAATCGTCACCGGCATCTGGCTCGCTTCCAAACCCGACAACCAATGCATCCGCTCCCTCCCCTGGCCGATCATCTTCCTCGGGGTTCTCTTCCTCCTCCTCTCCCTCACAGGCTTCATCGGAGCTCACTGGAACAACCAGGGGTTATTGTCCTTTTACCTCTTCTGCAACGCCGCACTCATAGTCACCGGAATCAT...

CDS

Download CDS FASTA

786 bp · LXL04_018612|LXL04_018612|OH1004|CDS

ATGGCAGTAAGCAACAACATAATAGCCACCATAAACTTCATAGCACTCATATGTTCAATCCCAATAATCGTCACCGGCATCTGGCTCGCTTCCAAACCCGACAACCAATGCATCCGCTCCCTCCCCTGGCCGATCATCTTCCTCGGGGTTCTCTTCCTCCTCCTCTCCCTCACAGGCTTCATCGGAGCTCACTGGAACAACCAGGGGTTATTGTCCTTTTACCTCTTCTGCAACGCCGCACTCATAGTCACCGGAATCAT...

Protein

Download Protein FASTA

261 aa · LXL04_018612|LXL04_018612|OH1004|PROTEIN

MAVSNNIIATINFIALICSIPIIVTGIWLASKPDNQCIRSLPWPIIFLGVLFLLLSLTGFIGAHWNNQGLLSFYLFCNAALIVTGIILLILAFIVVHPSGEYSVPGREYDEYRYMGYSEWLREHITDPENWRSIRACLASSSICPKMVRDSYSAPEFFAARISSLQSGCCKPPTVCGYQYVNPITWINPTNPVGDVDCMIWNNDPNQLCYNCDSCKAGVLGNLRKEWKEANVILIVAVVALVCLYLIAFNAYKNAQGGPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018612`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018612

Location Chr04:15579741-15580618 (-)

Description Similar to TET2: Tetraspanin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g19580`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At3g45600`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At5g46700`	Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization, as well as cell differentiation.	Tornado1 and tornado2 are required for the specification of radial and circumferential pattern in the Arabidopsis root.2000 · DOI: 10.1242/dev.127.15.3385 The ekeko mutant demonstrates a role for tetraspanin-like protein in plant development.2003 · DOI: 10.1016/j.bbrc.2003.09.122 The TORNADO1 and TORNADO2 genes function in several patterning processes during early leaf development in Arabidopsis thaliana.2006 · DOI: 10.1105/tpc.105.040568 Mutations in the TORNADO2 gene affect cellular decisions in the peripheral zone of the shoot apical meristem of Arabidopsis thaliana.2007 · DOI: 10.1007/s11103-006-9105-z Arabidopsis WIH1 and WIH2 genes act in the transition from somatic to reproductive cell fate.2011 · DOI: 10.1016/j.cub.2011.05.015
`At4g28050`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release
`At4g30430`	May be involved in the regulation of cell differentiation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018612 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009554 megasporogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0009956 radial pattern formation Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G19580

ath:AT3G45600

ath:AT4G28050

ath:AT4G30430

ath:AT5G46700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.729

Rank 1 · LXL04_018612 · OH-1004

Lysosome / Vacuole0.129

Rank 2 · LXL04_018612 · OH-1004

Cytoplasm0.100

Rank 3 · LXL04_018612 · OH-1004

Endoplasmic reticulum0.081

Rank 4 · LXL04_018612 · OH-1004

Golgi apparatus0.039

Rank 5 · LXL04_018612 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335.27Tetraspanin6-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018612	`PF00335.27`	Tetraspanin	6	247	8e-31	108.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUN5`	Arabidopsis thaliana	Tetraspanin-2	56.031%	Swiss-Prot	strong database homology
`Q9M1E7`	Arabidopsis thaliana	Tetraspanin-3	41.221%	Swiss-Prot	moderate database homology
`Q9FIQ5`	Arabidopsis thaliana	Protein TORNADO 2	43.750%	Swiss-Prot	moderate database homology
`Q9SUD4`	Arabidopsis thaliana	Tetraspanin-7	36.328%	Swiss-Prot	moderate database homology
`Q9M0B7`	Arabidopsis thaliana	Tetraspanin-9	34.902%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card