TkA08G070960 | RubberDandelionOmics

Gene overview

TkA08G070960

Reference: TK1151 Chr: Chr08 Coordinates: 18312333-18314124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

986 bp · TkA08G070960|TK1151|cDNA

TTGATACCTTCGGCATTGGAGATGACCTCAATATACTTGTGCAAGCCCACAAAAGAATCAGTAGTTAAAAACCGAAATGTCGTGCTGAGGTCATGACTTTCATTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAGCCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTT...

CDS

Download CDS FASTA

501 bp · TkA08G070960|TK1151|CDS

ATGACTTTCATTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAGCCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTTGATCAAGAAACTAACACCTGCGAAGACGAATTATTGGACGATGGATTACTTGAAGGCGAGAAAAAGAGAAGATCGCTAAAATTGGAACAAGT...

Protein

Download Protein FASTA

166 aa · TkA08G070960|TK1151|PROTEIN

MTFIGMAFFSNDFMPQASHKDDLHSPIFQTCTTSHDFHGIASLLGKRSMSYATELFDQETNTCEDELLDDGLLEGEKKRRSLKLEQVKTLERNFELGVSLIKRGKCSLRGNLSFNRDRSLFGFRTEGRDGRRSNWKRIMMCSRVNLKLSKLKTIRFCLKITSFMLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G070960`
TK1151 ID	TkA08G070960
OH-1004 ID	LXL04_011489
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.900
Protein coverage (%)	TK1151 81.928 / OH-1004 46.127 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G070960

Location Chr08:18312333-18314124 (+)

Description Similar to ATHB-13: Homeobox-leucine zipper protein ATHB-13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release
`At1g26960`	Probable transcription factor.	No verified direct reference in this release
`At3g01220`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XD08`	Probable transcription factor.	No verified direct reference in this release
`Os03g0170600`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011489 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0022622 root system development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0048527 lateral root development Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G26960

ath:AT1G69780

ath:AT3G01220

dosa:Os03g0170600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.862

Rank 1 · TkA08G070960 · TK1151

Cytoplasm0.179

Rank 2 · TkA08G070960 · TK1151

Cell membrane0.038

Rank 3 · TkA08G070960 · TK1151

Endoplasmic reticulum0.031

Rank 4 · TkA08G070960 · TK1151

Mitochondrion0.028

Rank 5 · TkA08G070960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC03`	Arabidopsis thaliana	sp\|Q8LC03\|ATB13_ARATH Homeobox-leucine zipper protein ATHB-13	40.300%	Swiss-Prot	Medium
`Q8LFD3`	Arabidopsis thaliana	sp\|Q8LFD3\|ATB23_ARATH Homeobox-leucine zipper protein ATHB-23	40.000%	Swiss-Prot	Medium
`Q8LAT0`	Arabidopsis thaliana	sp\|Q8LAT0\|ATB20_ARATH Homeobox-leucine zipper protein ATHB-20	36.100%	Swiss-Prot	Medium
`A2XD08`	Oryza sativa subsp. indica	sp\|A2XD08\|HOX21_ORYSI Homeobox-leucine zipper protein HOX21	36.400%	Swiss-Prot	Medium
`Q8S7W9`	Oryza sativa subsp. japonica	sp\|Q8S7W9\|HOX21_ORYSJ Homeobox-leucine zipper protein HOX21	36.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card