LXL04_011489 | RubberDandelionOmics

Gene overview

LXL04_011489

Reference: OH-1004 Chr: Chr02 Coordinates: 165471002-165472664 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_011489|LXL04_011489|OH1004|cDNA

ATGACTTTCATTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAGCCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTTGATCAAGAAACTAACACCTGCGAAGACGAATTATTGGACGATGGATTACTTGAAGGCGAGAAAAAGAGAAGATCGCTAAAATTGGAACAAGT...

CDS

Download CDS FASTA

855 bp · LXL04_011489|LXL04_011489|OH1004|CDS

ATGACTTTCATTGGAATGGCCTTCTTCTCTAATGATTTCATGCCACAAGCCTCTCATAAAGATGACCTTCACTCTCCGATTTTCCAAACTTGTACTACCAGTCACGACTTCCATGGAATAGCCTCGTTATTGGGGAAAAGATCAATGTCGTATGCAACAGAGCTATTTGATCAAGAAACTAACACCTGCGAAGACGAATTATTGGACGATGGATTACTTGAAGGCGAGAAAAAGAGAAGATCGCTAAAATTGGAACAAGT...

Protein

Download Protein FASTA

284 aa · LXL04_011489|LXL04_011489|OH1004|PROTEIN

MTFIGMAFFSNDFMPQASHKDDLHSPIFQTCTTSHDFHGIASLLGKRSMSYATELFDQETNTCEDELLDDGLLEGEKKRRSLKLEQVKTLERNFELGSKLDQERKMQLARELELQPRQVAIWFQNRRARWKTKQLEKDYDVLKSQFEAVKAQNDSLLSQNHKLHAQIMAIKNKDSSINLKVKETEGSCSNRIENSSEMIAHDHHHYQRNPNLLPPSIVDRSHQLFHNLSASTSADRHHQHHHYHLHGQKINQLVAMKEEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011489`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011489

Location Chr02:165471002-165472664 (+)

Description Similar to ATHB-13: Homeobox-leucine zipper protein ATHB-13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69780`	Probable transcription factor that may act in the sucrose-signaling pathway.	No verified direct reference in this release
`At1g26960`	Probable transcription factor.	No verified direct reference in this release
`At3g01220`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0170600`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2XD08`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011489 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0022622 root system development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0048527 lateral root development Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0048826 cotyledon morphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G26960

ath:AT1G69780

ath:AT3G01220

dosa:Os03g0170600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_011489 · OH-1004

Cytoplasm0.075

Rank 2 · LXL04_011489 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_011489 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_011489 · OH-1004

Plastid0.010

Rank 5 · LXL04_011489 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain77-131 aa

PF02183.24HALZ133-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011489	`PF00046.36`	Homeodomain	77	131	1.2e-16	60.9
LXL04_011489	`PF02183.24`	HALZ	133	173	1.6e-15	57.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC03`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-13	48.980%	Swiss-Prot	moderate database homology
`Q8LFD3`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-23	46.429%	Swiss-Prot	moderate database homology
`Q8LAT0`	Arabidopsis thaliana	Homeobox-leucine zipper protein ATHB-20	42.958%	Swiss-Prot	moderate database homology
`Q8S7W9`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein HOX21	45.675%	Swiss-Prot	moderate database homology
`A2XD08`	Oryza sativa subsp. indica	Homeobox-leucine zipper protein HOX21	44.983%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card