TkA08G069900 | RubberDandelionOmics

Gene overview

TkA08G069900

Reference: TK1151 Chr: Chr08 Coordinates: 18023411-18026549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1596 bp · TkA08G069900|TK1151|cDNA

GGTAAGTTCAGATTTCGATCTCCTTCTCGCCACTTTATCTCACAAAAAACGCACACATATTCCTCAACTCCACGGCGTCGATCCGAGGAGTTTGAGAAAACCCTAATCAAAAGCTTCTACTCATTCTCTCAGTCTCTTCAACACAACCAGTCATGGCGGGCATAGCACCAGAAGGATCTCAATTCGATGCACGACAATTTGACTCCAAAATGAGCGAGCTGCTTTCAGCTGATGGACAAGACTTCTTCACATCATACGAT...

CDS

Download CDS FASTA

1242 bp · TkA08G069900|TK1151|CDS

ATGGCGGGCATAGCACCAGAAGGATCTCAATTCGATGCACGACAATTTGACTCCAAAATGAGCGAGCTGCTTTCAGCTGATGGACAAGACTTCTTCACATCATACGATGAAGTTTATGACAGTTTTGATGCCATGGGCCTCCAAGAAAATCTCCTCAGAGGCATCTACGCATACGGTTTTGAAAAACCATCTGCAATCCAACAAAGAGGAATCGTCCCATTCACCAAGGGCATGGATGTAATTCAACAAGCCCAATCCGG...

Protein

Download Protein FASTA

413 aa · TkA08G069900|TK1151|PROTEIN

MAGIAPEGSQFDARQFDSKMSELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFTKGMDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRADYIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G069900`
TK1151 ID	TkA08G069900
OH-1004 ID	LXL04_018595
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G069900`
Location	Chr08:18023411-18026549 (+)
Description	Similar to Eukaryotic initiation factor 4A-15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018595` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002183 cytoplasmic translational initiation Biological Process GO:0010494 cytoplasmic stress granule Cellular Component GO:0003723 RNA binding Molecular Function GO:0003724 RNA helicase activity Molecular Function GO:0003743 translation initiation factor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function
KEGG gene cross-reference	nta:107783884 nta:107787142 nta:107814763 nta:107821770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA08G069900 · TK1151

Nucleus0.540

Rank 2 · TkA08G069900 · TK1151

Mitochondrion0.053

Rank 3 · TkA08G069900 · TK1151

Cell membrane0.052

Rank 4 · TkA08G069900 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA08G069900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11075DUF27803-52 aa

PF00270DEAD65-227 aa

PF07652Flavi_DEAD80-131 aa

PF04851ResIII83-223 aa

PF13245AAA_1983-194 aa

PF13401AAA_2284-224 aa

PF26224DUF805086-163 aa

PF00271Helicase_C109-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G069900	`PF11075`	DUF2780	3	52	0.04	14.7
TkA08G069900	`PF00270`	DEAD	65	227	2e-44	152.0
TkA08G069900	`PF07652`	Flavi_DEAD	80	131	0.16	12.7
TkA08G069900	`PF04851`	ResIII	83	223	1.6e-07	32.1
TkA08G069900	`PF13245`	AAA_19	83	194	0.018	15.9
TkA08G069900	`PF13401`	AAA_22	84	224	0.0018	19.3
TkA08G069900	`PF26224`	DUF8050	86	163	0.096	13.2
TkA08G069900	`PF00271`	Helicase_C	109	156	1.7e-34	119.1
TkA08G069900	`PF14617`	CMS1	159	190	0.014	15.5
TkA08G069900	`PF00271`	Helicase_C	208	244	1.7e-34	119.1
TkA08G069900	`PF04851`	ResIII	231	263	1.6e-07	32.1
TkA08G069900	`PF14617`	CMS1	242	291	0.014	15.5
TkA08G069900	`PF00271`	Helicase_C	266	374	1.7e-34	119.1
TkA08G069900	`PF13245`	AAA_19	273	314	0.018	15.9
TkA08G069900	`PF00270`	DEAD	291	336	2e-44	152.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card