Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1475 bp · LXL04_018595|LXL04_018595|OH1004|cDNA
CTTAAGAATCTGCCAAGGAAACTTTCTAATTTATTATGTCCACAAAGGGCAAAATCGTCAAACAAGAAAAAGGGAAAATAGGGTAAGTTCAGATTTCGATCTCCTTCTCGCCACTTTATCTCACAAAAAACGCACACATATTCCTCAACTCCACGGCGTCGATCCGAGGAGTTTGAGAAAACCCTAATCAAAAGCTTCTACTCATTCTCTCAGTCTCTTCAACACAACCAGTCATGGCGGGCATAGCACCAGAAGGATCT...
1242 bp · LXL04_018595|LXL04_018595|OH1004|CDS
ATGGCGGGCATAGCACCAGAAGGATCTCAATTCGATGCACGACAATTTGACTCCAAAATGAGCGAGCTGCTTTCAGCTGATGGACAAGACTTCTTCACATCATACGATGAAGTTTATGACAGTTTTGATGCCATGGGCCTCCAAGAAAATCTCCTCAGAGGCATCTACGCATACGGTTTTGAAAAACCATCTGCAATCCAACAAAGAGGAATCGTCCCATTCACCAAGGGCATGGATGTAATTCAACAAGCCCAATCCGG...
Protein
Download Protein FASTA413 aa · LXL04_018595|LXL04_018595|OH1004|PROTEIN
MAGIAPEGSQFDARQFDSKMSELLSADGQDFFTSYDEVYDSFDAMGLQENLLRGIYAYGFEKPSAIQQRGIVPFTKGMDVIQQAQSGTGKTATFCSGILQQLDYNVVECQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILSAGVHVVVGTPGRVFDMLRRQSLRADYIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018595 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018595 |
|---|---|
| Location | Chr04:15329426-15332508 (+) |
| Description | Similar to Eukaryotic initiation factor 4A-15 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002183 cytoplasmic translational initiation Biological Process GO:0010494 cytoplasmic stress granule Cellular Component GO:0003723 RNA binding Molecular Function GO:0003724 RNA helicase activity Molecular Function GO:0003743 translation initiation factor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function |
| KEGG gene cross-reference | nta:107783884 nta:107787142 nta:107814763 nta:107821770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00270.36DEAD65-227 aaPF04851.22ResIII83-223 aaPF00271.38Helicase_C266-374 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018595 | PF00270.36 | DEAD | 65 | 227 | 2e-44 | 152.0 |
| LXL04_018595 | PF04851.22 | ResIII | 83 | 223 | 1.6e-07 | 32.1 |
| LXL04_018595 | PF00271.38 | Helicase_C | 266 | 374 | 1.7e-34 | 119.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.