TkA08G069180 | RubberDandelionOmics

Gene overview

TkA08G069180

Reference: TK1151 Chr: Chr08 Coordinates: 17818495-17819058 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA08G069180|TK1151|cDNA

ATGGCTAGAATTACCATTAACATTACCAAGACGGTTAACCATCCCGATAACGAGAAAGGAAGATGGTCAAAAGGTTACGCTGTCGCGAGCGTAACCCTATCCCCTTCCCTCATCGCGTTCCTATGGAACGCGCAACATGCAGACAGCCGATTATCTGTATGGCTAATCTACTTATCCAGCGCAGCAATCAGCTGTCTGCTAGGAGGGTTCGCGTTTAAATTCTCAAACGCGAACCACCCGCCTCGTAAATGGCTCCTCCC...

CDS

Download CDS FASTA

564 bp · TkA08G069180|TK1151|CDS

ATGGCTAGAATTACCATTAACATTACCAAGACGGTTAACCATCCCGATAACGAGAAAGGAAGATGGTCAAAAGGTTACGCTGTCGCGAGCGTAACCCTATCCCCTTCCCTCATCGCGTTCCTATGGAACGCGCAACATGCAGACAGCCGATTATCTGTATGGCTAATCTACTTATCCAGCGCAGCAATCAGCTGTCTGCTAGGAGGGTTCGCGTTTAAATTCTCAAACGCGAACCACCCGCCTCGTAAATGGCTCCTCCC...

Protein

Download Protein FASTA

187 aa · TkA08G069180|TK1151|PROTEIN

MARITINITKTVNHPDNEKGRWSKGYAVASVTLSPSLIAFLWNAQHADSRLSVWLIYLSSAAISCLLGGFAFKFSNANHPPRKWLLPWVLGGFFMSIIWFYIIANELVSLLVAFGLIFSINPSILGLTVLAWGNSMGDLMSNVALAVNGGEGVQIAISGCYAGPMFNTLAGLGICMLIGSWSKTGVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G069180`
TK1151 ID	TkA08G069180
OH-1004 ID	LXL04_018580
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 96.257 / OH-1004 29.654 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G069180

Location Chr08:17818495-17819058 (+)

Description Similar to CCX4: Cation/calcium exchanger 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14070`	May act as an endomembrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At1g54115`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	AtCCX3 is an Arabidopsis endomembrane H+ -dependent K+ transporter.2008 · DOI: 10.1104/pp.108.118810
`At5g17850`	Membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At5g17860`	Vacuolar membrane-localized H(+)-dependent K(+) and Na(+) transporter.	No verified direct reference in this release
`At1g08960`	May act as a membrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.	Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K⁺ uptake and Na⁺ transport in yeast.2011 · DOI: 10.1016/j.bbrc.2011.09.030

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0010150 leaf senescence Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0043157 response to cation stress Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G08960

ath:AT1G54115

ath:AT3G14070

ath:AT5G17850

ath:AT5G17860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.429

Rank 1 · TkA08G069180 · TK1151

Cell membrane0.297

Rank 2 · TkA08G069180 · TK1151

Cytoplasm0.178

Rank 3 · TkA08G069180 · TK1151

Endoplasmic reticulum0.132

Rank 4 · TkA08G069180 · TK1151

Golgi apparatus0.114

Rank 5 · TkA08G069180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13727CoA_binding_330-67 aa

PF248388xMP36-65 aa

PF01699Na_Ca_ex52-57 aa

PF13727CoA_binding_352-104 aa

PF248388xMP62-104 aa

PF01699Na_Ca_ex89-183 aa

PF248388xMP107-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G069180	`PF13727`	CoA_binding_3	30	67	0.99	10.1
TkA08G069180	`PF24838`	8xMP	36	65	1.1	9.8
TkA08G069180	`PF01699`	Na_Ca_ex	52	57	1.1e-22	81.3
TkA08G069180	`PF13727`	CoA_binding_3	52	104	0.99	10.1
TkA08G069180	`PF24838`	8xMP	62	104	1.1	9.8
TkA08G069180	`PF01699`	Na_Ca_ex	89	183	1.1e-22	81.3
TkA08G069180	`PF24838`	8xMP	107	120	1.1	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJI2`	Arabidopsis thaliana	sp\|Q9LJI2\|CCX3_ARATH Cation/calcium exchanger 3	59.800%	Swiss-Prot	High
`Q9SYG9`	Arabidopsis thaliana	sp\|Q9SYG9\|CCX4_ARATH Cation/calcium exchanger 4	58.200%	Swiss-Prot	High
`Q9FKP2`	Arabidopsis thaliana	sp\|Q9FKP2\|CCX2_ARATH Cation/calcium exchanger 2	48.600%	Swiss-Prot	Medium
`Q9FKP1`	Arabidopsis thaliana	sp\|Q9FKP1\|CCX1_ARATH Cation/calcium exchanger 1	49.400%	Swiss-Prot	Medium
`O04034`	Arabidopsis thaliana	sp\|O04034\|CCX5_ARATH Cation/calcium exchanger 5	33.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card