TkA08G064620 | RubberDandelionOmics

Gene overview

TkA08G064620

Reference: TK1151 Chr: Chr08 Coordinates: 16487583-16489258 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

891 bp · TkA08G064620|TK1151|cDNA

CGTCGAGGAAGTTGACCTGTGCTGCTGAGGAACGGCCTGCTTTCAGTTTCTCCATTCTATCTAGTGGAATGATGGCCGGAGACTCGTCGGAATCAGTTCACCCTTTTATACCTTCAGATCTCATTCTGCCGGATTATGTACCGATTATACTCTCTCAATCTACCATTCTCAGTGTTTATGGCTGCGCTTCCTTGCTTGTCGTCTCCTTCGTCTGGATCCTCGCCGGCCGGTTTCCTAAAATATCAAAACTCGACAAATCT...

CDS

Download CDS FASTA

681 bp · TkA08G064620|TK1151|CDS

ATGATGGCCGGAGACTCGTCGGAATCAGTTCACCCTTTTATACCTTCAGATCTCATTCTGCCGGATTATGTACCGATTATACTCTCTCAATCTACCATTCTCAGTGTTTATGGCTGCGCTTCCTTGCTTGTCGTCTCCTTCGTCTGGATCCTCGCCGGCCGGTTTCCTAAAATATCAAAACTCGACAAATCTCTCATGTGCTGGTGGGTTTTCACTGGCCTCACTCACATGATCCTCGAAGGTTACTTTGTTTTCACTCC...

Protein

Download Protein FASTA

226 aa · TkA08G064620|TK1151|PROTEIN

MMAGDSSESVHPFIPSDLILPDYVPIILSQSTILSVYGCASLLVVSFVWILAGRFPKISKLDKSLMCWWVFTGLTHMILEGYFVFTPEFFKQTNPTYLAEVWKEYSKGDSRYVGRDSAVVAIEGITAILEGPACILAAYAIATRKSYSHILQISIALGQLYGTAVYFITSYLEGDNFAASPLYYYSYYIFANSFWVWIPSLIVIRSWKKICAAVGPTQEQKKTKRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G064620`
TK1151 ID	TkA08G064620
OH-1004 ID	LXL04_018496
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G064620

Location Chr08:16487583-16489258 (-)

Description Similar to Os01g0103600: Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20050`	Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0103600`	Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018496 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016126 sterol biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0000247 C-8 sterol isomerase activity Molecular Function

GO:0004769 steroid Delta-isomerase activity Molecular Function

GO:0047750 cholestenol delta-isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20050

dosa:Os01g0103600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.685

Rank 1 · TkA08G064620 · TK1151

Golgi apparatus0.165

Rank 2 · TkA08G064620 · TK1151

Nucleus0.099

Rank 3 · TkA08G064620 · TK1151

Cytoplasm0.094

Rank 4 · TkA08G064620 · TK1151

Cell membrane0.089

Rank 5 · TkA08G064620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05241EBP36-91 aa

PF19391DUF596645-89 aa

PF05241EBP98-206 aa

PF15207TMEM240145-216 aa

PF19391DUF5966154-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G064620	`PF05241`	EBP	36	91	9.1e-24	84.7
TkA08G064620	`PF19391`	DUF5966	45	89	0.97	11.0
TkA08G064620	`PF05241`	EBP	98	206	9.1e-24	84.7
TkA08G064620	`PF15207`	TMEM240	145	216	0.16	12.3
TkA08G064620	`PF19391`	DUF5966	154	198	0.97	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48962`	Arabidopsis thaliana	sp\|O48962\|EBP_ARATH Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase	66.400%	Swiss-Prot	High
`Q9FTZ2`	Oryza sativa subsp. japonica	sp\|Q9FTZ2\|EBP_ORYSJ Probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase	61.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card