Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1206 bp · TkA08G063230|TK1151|cDNA
GGTGTCTTTCTGGAAAACTGACGCGTGATTCACCGGATCCATACCATTCCAATAAAATCTCTCTTTGTGGATCAAACGAAACCAGGCAGCACCCCTCCTTCTCTCTTCTCTTCTCGCAGGAAGCAACTGATCCTTCTCTCTTCTCTTCTCCAATTTCTCTGTCGTTCTCAGGTTTGGATCAAAGGGGAAGACGAGAGTGCCTTCCCTCTGCCAGTCCGGCCAAACCGAAGTCAGCCCTCCTCCACATCGCCGGCGCCTTT...
498 bp · TkA08G063230|TK1151|CDS
ATGAACAAGGTTTTAGGTACAAAAGTAATTTTAGGTACTCAGGAAGAAGAATTCTGTAATACACATGTGGAACCTGTTGAACAAGATCATAACATATCAGAAGAAAGGAAGGATCTTTCTTCCCCTCATTTGGTCACAGATAAAGATGTTGAGGAAGGAGAAATCTCAGGAGAGTTTTTGAATTTGATTCCTGAAGATGACGTGGTATCTGTGGACAAAACAGGGTCTGCTCAATTGACTGTATTGAGTTCGTTGGACGG...
Protein
Download Protein FASTA165 aa · TkA08G063230|TK1151|PROTEIN
MNKVLGTKVILGTQEEEFCNTHVEPVEQDHNISEERKDLSSPHLVTDKDVEEGEISGEFLNLIPEDDVVSVDKTGSAQLTVLSSLDGIIDTVSANHPIAPLLSVLKPPGKLVLVGAPEKSPELIPFSLISADFDSNVPLMVSSGSFVAGGQVEKLEKDEESIDSD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G063230 |
|---|---|
| TK1151 ID | TkA08G063230 |
| OH-1004 ID | LXL04_002285 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 99.394 / OH-1004 86.772Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G063230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:16167858-16169849 (-) | |||||||||
| Description | Similar to 10HGO: 8-hydroxygeraniol dehydrogenase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009809 lignin biosynthetic process Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function GO:0046029 mannitol dehydrogenase activity Molecular Function GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function GO:0102311 8-hydroxygeraniol dehydrogenase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAC15467 dosa:Os08g0270466 dosa:Os09g0400400 dosa:Os10g0430200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13602ADH_zinc_N_267-127 aaPF00107ADH_zinc_N83-129 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G063230 | PF13602 | ADH_zinc_N_2 | 67 | 127 | 0.15 | 13.7 |
| TkA08G063230 | PF00107 | ADH_zinc_N | 83 | 129 | 0.0002 | 22.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.