LXL04_002285 | RubberDandelionOmics

Gene overview

LXL04_002285

Reference: OH-1004 Chr: Chr01 Coordinates: 45262485-45263997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · LXL04_002285|LXL04_002285|OH1004|cDNA

ATGGTTGCAACAAGGAAAGGGGAACGCGGTGATGAGCTGGATTTCTTCCGATTCAGGGAATTAGATTTAGAACAGAGTGAGGTTTTAGGTACAAAAGTAATTTTAGGTACTCAGGAAGAAGAATTCTGTAATACACATGTGGAACCTGTTGAACAAGATCATAACATATCAGAAGAAAGGAAGGATCTTTCTTCCCCTCATTTGGTCACAGATAAAGATGTTGAGGAAGGAGAAATCTCAGGAGAGTTTTTGAATTTGAT...

CDS

Download CDS FASTA

570 bp · LXL04_002285|LXL04_002285|OH1004|CDS

ATGGTTGCAACAAGGAAAGGGGAACGCGGTGATGAGCTGGATTTCTTCCGATTCAGGGAATTAGATTTAGAACAGAGTGAGGTTTTAGGTACAAAAGTAATTTTAGGTACTCAGGAAGAAGAATTCTGTAATACACATGTGGAACCTGTTGAACAAGATCATAACATATCAGAAGAAAGGAAGGATCTTTCTTCCCCTCATTTGGTCACAGATAAAGATGTTGAGGAAGGAGAAATCTCAGGAGAGTTTTTGAATTTGAT...

Protein

Download Protein FASTA

189 aa · LXL04_002285|LXL04_002285|OH1004|PROTEIN

MVATRKGERGDELDFFRFRELDLEQSEVLGTKVILGTQEEEFCNTHVEPVEQDHNISEERKDLSSPHLVTDKDVEEGEISGEFLNLIPEDDVVSVDKTGSAQLTVLSSLDGIIDTVSANHPIAPLLSVLKPPGKLVLVGAPEKSPELIPFSLISADFDSNVPLMVSSGSFVAGGQVEKLEKDEESIDSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002285`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002285

Location Chr01:45262485-45263997 (-)

Description Similar to 10HGO: 8-hydroxygeraniol dehydrogenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q0J6T3`	Involved in lignin biosynthesis.	No verified direct reference in this release
`Os10g0430200`	Involved in lignin biosynthesis.	No verified direct reference in this release
`Os09g0400400`	Involved in lignin biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002285 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0046029 mannitol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

GO:0102311 8-hydroxygeraniol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:AAC15467

dosa:Os08g0270466

dosa:Os09g0400400

dosa:Os10g0430200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561

Rank 1 · LXL04_002285 · OH-1004

Nucleus0.404

Rank 2 · LXL04_002285 · OH-1004

Mitochondrion0.078

Rank 3 · LXL04_002285 · OH-1004

Cell membrane0.066

Rank 4 · LXL04_002285 · OH-1004

Endoplasmic reticulum0.063

Rank 5 · LXL04_002285 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0J6T3`	Oryza sativa subsp. japonica	Probable cinnamyl alcohol dehydrogenase 5	50.000%	Swiss-Prot	weak database homology
`Q337Y2`	Oryza sativa subsp. japonica	Probable cinnamyl alcohol dehydrogenase 3	40.698%	Swiss-Prot	weak database homology
`Q6ERW5`	Oryza sativa subsp. japonica	Probable cinnamyl alcohol dehydrogenase 8D	43.836%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card