TkA08G059200 | RubberDandelionOmics

Gene overview

TkA08G059200

Reference: TK1151 Chr: Chr08 Coordinates: 15169666-15171835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1250 bp · TkA08G059200|TK1151|cDNA

GAACATTTGGGTTTTGCTTATTGGACTGCAACTTAATGGGCTTAAGATGAACTGATGGACTTGAAACACCTGCGATCATGGCGGGAATTAGAATACGATGGCGGGAGAACCCTCCACAAGCCGTCTTAAGGTTTCTCTTTTGCAATTTCGTGCAGTAGAATATCTTCTCTGACTGACTTCGATTGCGTAATCTAACAGTAAACCGCTCTCTTCCTTGAAATGGGTAAACGAAAGAAATCTGCTGTTCATGAAGAAAACAT...

CDS

Download CDS FASTA

870 bp · TkA08G059200|TK1151|CDS

ATGGGTAAACGAAAGAAATCTGCTGTTCATGAAGAAAACATAGAAGAAGAAGATGAACAACAACAAGAAACTCGCGGTGAATCTTCATCCTCTTCGAATACTACGAGCTTGTACGAGATTCTTGGAGTGGAAAAGACAGCATCTCAACAAGAAATAAAAAAGGCGTATCATAAGTTGGCATTACGTCTACACCCTGATAAGAACCCTAATGACGAGGATGCCAAAGAGAAGTTTCAACAACTGCAGAAAGTTATATCAAT...

Protein

Download Protein FASTA

289 aa · TkA08G059200|TK1151|PROTEIN

MGKRKKSAVHEENIEEEDEQQQETRGESSSSSNTTSLYEILGVEKTASQQEIKKAYHKLALRLHPDKNPNDEDAKEKFQQLQKVISILGDEEKRALYDQTGCVDDAELAGDVAQNLKNFFRTMYKKVTEADIEEFESNYRGSESEKNDLIELYTKYKGHMNRLFCSMLCSDPKLDSHRFKDILDEAISSGEVKLTKAYKKWANKVSETKPPTDPLKRSGNSKKESDDLYAIISQRQSERKGRLDAMFSSLVGRYGGERGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G059200`
TK1151 ID	TkA08G059200
OH-1004 ID	LXL04_018418
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 90.311 / OH-1004 69.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G059200

Location Chr08:15169666-15171835 (+)

Description Similar to ATJ6: Chaperone protein dnaJ 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06910`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018418 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0032781 positive regulation of ATP-dependent activity Biological Process

GO:0036205 histone catabolic process Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0101031 protein folding chaperone complex Cellular Component

GO:0030544 Hsp70 protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G06910

dme:Dmel_CG6693

hsa:23234

mmu:108671

spo:2542992

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.662

Rank 1 · TkA08G059200 · TK1151

Cytoplasm0.382

Rank 2 · TkA08G059200 · TK1151

Cell membrane0.040

Rank 3 · TkA08G059200 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA08G059200 · TK1151

Mitochondrion0.032

Rank 5 · TkA08G059200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30091SLX5_helical6-35 aa

PF07007LprI28-82 aa

PF00226DnaJ37-98 aa

PF30912TIM141_C39-67 aa

PF23302HTH_DNAJC950-58 aa

PF11934DUF345252-68 aa

PF02561FliS71-134 aa

PF11934DUF3452100-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G059200	`PF30091`	SLX5_helical	6	35	0.15	12.6
TkA08G059200	`PF07007`	LprI	28	82	0.027	15.6
TkA08G059200	`PF00226`	DnaJ	37	98	1.2e-26	93.3
TkA08G059200	`PF30912`	TIM141_C	39	67	0.058	14.1
TkA08G059200	`PF23302`	HTH_DNAJC9	50	58	1.5e-25	89.9
TkA08G059200	`PF11934`	DUF3452	52	68	0.14	12.5
TkA08G059200	`PF02561`	FliS	71	134	0.0081	16.8
TkA08G059200	`PF11934`	DUF3452	100	168	0.14	12.5
TkA08G059200	`PF23302`	HTH_DNAJC9	139	206	1.5e-25	89.9
TkA08G059200	`PF30091`	SLX5_helical	143	162	0.15	12.6
TkA08G059200	`PF07007`	LprI	180	212	0.027	15.6
TkA08G059200	`PF00226`	DnaJ	191	205	1.2e-26	93.3
TkA08G059200	`PF23302`	HTH_DNAJC9	220	249	1.5e-25	89.9
TkA08G059200	`PF07007`	LprI	227	261	0.027	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL54`	Arabidopsis thaliana	sp\|Q9FL54\|DNAJ6_ARATH Chaperone protein dnaJ 6	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card