LXL04_018418 | RubberDandelionOmics

Gene overview

LXL04_018418

Reference: OH-1004 Chr: Chr04 Coordinates: 12644365-12647371 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · LXL04_018418|LXL04_018418|OH1004|cDNA

ATGGGTAAACGAAAGAAATCTGCTGTTCATGAAGAAAAcatagaagaagaagatgaacaacAACAAGAAACTCGCGGTGAATCTTCATCCTCTTCGAATACTACGAGCTTGTACGAGATTCTTGGAGTGGAAAAGACAGCATCTCAACAAGAAATAAAAAAGGCGTATCATAAGTTGGCATTACGTCTACACCCTGATAAGAACCCTAATGACGAGGATGCCAAAGAGAAGTTTCAACAACTGCAGAAAGTTATATCAAT...

CDS

Download CDS FASTA

1125 bp · LXL04_018418|LXL04_018418|OH1004|CDS

ATGGGTAAACGAAAGAAATCTGCTGTTCATGAAGAAAACATAGAAGAAGAAGATGAACAACAACAAGAAACTCGCGGTGAATCTTCATCCTCTTCGAATACTACGAGCTTGTACGAGATTCTTGGAGTGGAAAAGACAGCATCTCAACAAGAAATAAAAAAGGCGTATCATAAGTTGGCATTACGTCTACACCCTGATAAGAACCCTAATGACGAGGATGCCAAAGAGAAGTTTCAACAACTGCAGAAAGTTATATCAAT...

Protein

Download Protein FASTA

374 aa · LXL04_018418|LXL04_018418|OH1004|PROTEIN

MGKRKKSAVHEENIEEEDEQQQETRGESSSSSNTTSLYEILGVEKTASQQEIKKAYHKLALRLHPDKNPNDEDAKEKFQQLQKVISILGDEEKRALYDQTGCVDDAELAGDVAQNLKNFFRTMYKKVTEADIEEFESNYRGSESEKNDLIELYTKYKGHMNRLFCSMLCSDPKLDSHRFKDILDEAISSGEVKLTKAYKKWANKVSETKPPTDPLKRSGNSKKESDDLYAIISQRQSERKGRLDAMFSSLVGKYGGERGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018418`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018418

Location Chr04:12644365-12647371 (+)

Description Similar to ATJ6: Chaperone protein dnaJ 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06910`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018418 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0032781 positive regulation of ATP-dependent activity Biological Process

GO:0036205 histone catabolic process Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0101031 protein folding chaperone complex Cellular Component

GO:0030544 Hsp70 protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G06910

dme:Dmel_CG6693

hsa:23234

mmu:108671

spo:2542992

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.444

Rank 1 · LXL04_018418 · OH-1004

Nucleus0.317

Rank 2 · LXL04_018418 · OH-1004

Cytoplasm0.202

Rank 3 · LXL04_018418 · OH-1004

Cell membrane0.126

Rank 4 · LXL04_018418 · OH-1004

Golgi apparatus0.089

Rank 5 · LXL04_018418 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ37-98 aa

PF23302.2HTH_DNAJC9139-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018418	`PF00226.37`	DnaJ	37	98	2.3e-26	92.4
LXL04_018418	`PF23302.2`	HTH_DNAJC9	139	206	4.4e-25	88.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL54`	Arabidopsis thaliana	Chaperone protein dnaJ 6	62.759%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card