TkA08G058710 | RubberDandelionOmics

Gene overview

TkA08G058710

Reference: TK1151 Chr: Chr08 Coordinates: 15008264-15010525 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1719 bp · TkA08G058710|TK1151|cDNA

ATGTCCCAATTGAAAGAATCGGAACACCTTAAAATACCATTCAAAGAGATAGAATCAGCAACCAACAACTTCCAAACTTGTATCGGAAAAGGTGGATACGGTCGGGTGTACAGAGGAGAGCTTCCCATATCCGGAACCCTCACCACAGTCGCTGTAAAACGCCTCTACGAGCAATTCGGACAAGGATCCAAGGATATATTTGACCTGAGAGTCTCAGGTCAAAAACACCCAAATCTGATCTCGCTTCTTGGTTATTGCGA...

CDS

Download CDS FASTA

1605 bp · TkA08G058710|TK1151|CDS

ATGTCCCAATTGAAAGAATCGGAACACCTTAAAATACCATTCAAAGAGATAGAATCAGCAACCAACAACTTCCAAACTTGTATCGGAAAAGGTGGATACGGTCGGGTGTACAGAGGAGAGCTTCCCATATCCGGAACCCTCACCACAGTCGCTGTAAAACGCCTCTACGAGCAATTCGGACAAGGATCCAAGGATATATTTGACCTGAGAGTCTCAGGTCAAAAACACCCAAATCTGATCTCGCTTCTTGGTTATTGCGA...

Protein

Download Protein FASTA

534 aa · TkA08G058710|TK1151|PROTEIN

MSQLKESEHLKIPFKEIESATNNFQTCIGKGGYGRVYRGELPISGTLTTVAVKRLYEQFGQGSKDIFDLRVSGQKHPNLISLLGYCEEGNEKIIVYEFVERGSLDKYIKHPDLTWPERLKICVHIARGLEHLHNHVGKHQTIIHRDIKSANILVDQNWVAKISDLGLSKLTLSGLNRSAIISHACGTPGYCEPEYITTGIVKKESDVYSFGVVLLEILCGRLCTIRDGHGLLLLDYYKMKKLEEIIDPSLRKQMSSYSMN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058710`
TK1151 ID	TkA08G058710
OH-1004 ID	LXL04_018398
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 55.431 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058710

Location Chr08:15008264-15010525 (+)

Description Similar to At1g05150: Uncharacterized TPR repeat-containing protein At1g05150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At2g23200`	Probable receptor-like protein kinase At2g23200.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release
`At5g18500`	Probable receptor-like protein kinase At5g18500.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018398 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05150

ath:AT2G32450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.543

Rank 1 · TkA08G058710 · TK1151

Endoplasmic reticulum0.172

Rank 2 · TkA08G058710 · TK1151

Cytoplasm0.166

Rank 3 · TkA08G058710 · TK1151

Nucleus0.130

Rank 4 · TkA08G058710 · TK1151

Golgi apparatus0.073

Rank 5 · TkA08G058710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr24-287 aa

PF00069Pkinase26-285 aa

PF03109ABC127-59 aa

PF03109ABC190-168 aa

PF01636APH128-159 aa

PF00036EF-hand_1335-357 aa

PF13405EF-hand_6335-357 aa

PF13499EF-hand_7335-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058710	`PF07714`	PK_Tyr_Ser-Thr	24	287	7.9e-39	134.2
TkA08G058710	`PF00069`	Pkinase	26	285	8.7e-37	127.7
TkA08G058710	`PF03109`	ABC1	27	59	0.11	12.3
TkA08G058710	`PF03109`	ABC1	90	168	0.11	12.3
TkA08G058710	`PF01636`	APH	128	159	0.05	14.1
TkA08G058710	`PF00036`	EF-hand_1	335	357	0.00012	22.1
TkA08G058710	`PF13405`	EF-hand_6	335	357	0.00017	21.8
TkA08G058710	`PF13499`	EF-hand_7	335	357	0.015	16.4
TkA08G058710	`PF13202`	EF-hand_5	336	357	4.2e-05	23.6
TkA08G058710	`PF13833`	EF-hand_8	336	358	0.073	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	43.000%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	42.300%	Swiss-Prot	Medium
`O22187`	Arabidopsis thaliana	sp\|O22187\|Y2232_ARATH Probable receptor-like protein kinase At2g23200	42.100%	Swiss-Prot	Medium
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	39.700%	Swiss-Prot	Medium
`Q8LEB6`	Arabidopsis thaliana	sp\|Q8LEB6\|Y5185_ARATH Probable receptor-like protein kinase At5g18500	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card