TkA08G057640 | RubberDandelionOmics

Gene overview

TkA08G057640

Reference: TK1151 Chr: Chr08 Coordinates: 14728078-14729610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · TkA08G057640|TK1151|cDNA

ATGGAACTGCCTTTTGTTCATGACGTGTACCGATCAGAAATTGAGGAAGCTCGTCAAGACTTACGTGATCTCATCATTAAGAAAAATTGCGCCCCAATCATGCTCCGTTTAGCATTTCACGATGCTGCAACTTACTGCAAGGATACAAAAACGGGAGGCCCAAATGGCTCGATTAGGATGCCCGAAGAGTATGAACAAAGCGTTAACAAAGGACTTAAAACTGCCATTGATTTTTGCGAAGAAATAAAGTTAAAGCATCC...

CDS

Download CDS FASTA

570 bp · TkA08G057640|TK1151|CDS

ATGGAACTGCCTTTTGTTCATGACGTGTACCGATCAGAAATTGAGGAAGCTCGTCAAGACTTACGTGATCTCATCATTAAGAAAAATTGCGCCCCAATCATGCTCCGTTTAGCATTTCACGATGCTGCAACTTACTGCAAGGATACAAAAACGGGAGGCCCAAATGGCTCGATTAGGATGCCCGAAGAGTATGAACAAAGCGTTAACAAAGGACTTAAAACTGCCATTGATTTTTGCGAAGAAATAAAGTTAAAGCATCC...

Protein

Download Protein FASTA

189 aa · TkA08G057640|TK1151|PROTEIN

MELPFVHDVYRSEIEEARQDLRDLIIKKNCAPIMLRLAFHDAATYCKDTKTGGPNGSIRMPEEYEQSVNKGLKTAIDFCEEIKLKHPLLTYADIYQLAGVVAVEIAGGPTINFLPGRKDSEEWTAEGRLPGGETDIKQLMDKCDRMGLHVADIATLWGAHILDRAQEDRSDFDSPWTGKPLKFDNSYFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057640`
TK1151 ID	TkA08G057640
OH-1004 ID	LXL04_024675
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.400
Protein coverage (%)	TK1151 97.884 / OH-1004 65.493 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G057640

Location Chr08:14728078-14729610 (-)

Description Similar to APX3: L-ascorbate peroxidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35000`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`At4g35970`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0223300`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`UniProt: Q01MI9`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`Os08g0549100`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024675 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G35000

ath:AT4G35970

dosa:Os04g0223300

dosa:Os08g0549100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.699

Rank 1 · TkA08G057640 · TK1151

Nucleus0.344

Rank 2 · TkA08G057640 · TK1151

Mitochondrion0.099

Rank 3 · TkA08G057640 · TK1151

Peroxisome0.069

Rank 4 · TkA08G057640 · TK1151

Extracellular0.033

Rank 5 · TkA08G057640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase18-188 aa

PF30582DUF864897-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057640	`PF00141`	peroxidase	18	188	5.6e-33	115.4
TkA08G057640	`PF30582`	DUF8648	97	150	0.25	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42564`	Arabidopsis thaliana	sp\|Q42564\|APX3_ARATH L-ascorbate peroxidase 3	59.600%	Swiss-Prot	High
`Q7XZP5`	Arabidopsis thaliana	sp\|Q7XZP5\|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal	58.100%	Swiss-Prot	High
`Q0JEQ2`	Oryza sativa subsp. japonica	sp\|Q0JEQ2\|APX3_ORYSJ Probable L-ascorbate peroxidase 3, peroxisomal	58.900%	Swiss-Prot	High
`Q01MI9`	Oryza sativa subsp. indica	sp\|Q01MI9\|APX3_ORYSI Probable L-ascorbate peroxidase 3	58.400%	Swiss-Prot	High
`Q6ZJJ1`	Oryza sativa subsp. japonica	sp\|Q6ZJJ1\|APX4_ORYSJ Probable L-ascorbate peroxidase 4, peroxisomal	56.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card