LXL04_024675 | RubberDandelionOmics

Gene overview

LXL04_024675

Reference: OH-1004 Chr: Chr05 Coordinates: 96527011-96529073 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · LXL04_024675|LXL04_024675|OH1004|cDNA

ATGGCGGCAGCAGCTCCTATAGTGAACGCAGAGTATTTGAAGGAGATAGAAAAGGCTCGTCGAGATCTTCGTGCTCTCATCTCCAACAAAAAATGTGCTCCAATCATGCTTCGCTTAGCATGGCACGATGCAGGCACTTATGATGCTACTACAAGAACAGGAGGCCCAAATGGATCAATCAGACTCAAGGAAGAGTACACTCATGGAGCAAACAGTGGTTTGAAAATTGCAATTGATCTCTGTGAAGAAGTGAAGGCCAA...

CDS

Download CDS FASTA

855 bp · LXL04_024675|LXL04_024675|OH1004|CDS

ATGGCGGCAGCAGCTCCTATAGTGAACGCAGAGTATTTGAAGGAGATAGAAAAGGCTCGTCGAGATCTTCGTGCTCTCATCTCCAACAAAAAATGTGCTCCAATCATGCTTCGCTTAGCATGGCACGATGCAGGCACTTATGATGCTACTACAAGAACAGGAGGCCCAAATGGATCAATCAGACTCAAGGAAGAGTACACTCATGGAGCAAACAGTGGTTTGAAAATTGCAATTGATCTCTGTGAAGAAGTGAAGGCCAA...

Protein

Download Protein FASTA

284 aa · LXL04_024675|LXL04_024675|OH1004|PROTEIN

MAAAAPIVNAEYLKEIEKARRDLRALISNKKCAPIMLRLAWHDAGTYDATTRTGGPNGSIRLKEEYTHGANSGLKIAIDLCEEVKAKHPRVTYADLYQLAGVVAVEVTGGPTIEFVPGRKDSNDSTNEGRLPDAKQGPPHLRDVFYRMGLSDKDIVALSGGHTLGKAHPERSGFDEKPWTKDPLKFDNSYFVELLKGDDSDGLLKLPTDIALLDDPNFRTYVELYAKDEDVFFKDYAESHKKLSELGFTPPLTMTALFAQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024675`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024675

Location Chr05:96527011-96529073 (-)

Description Similar to APX3: L-ascorbate peroxidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35000`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`At4g35970`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0223300`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`UniProt: Q01MI9`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release
`Os08g0549100`	Plays a key role in hydrogen peroxide removal.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024675 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G35000

ath:AT4G35970

dosa:Os04g0223300

dosa:Os08g0549100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.240

Rank 1 · LXL04_024675 · OH-1004

Mitochondrion0.200

Rank 2 · LXL04_024675 · OH-1004

Cytoplasm0.194

Rank 3 · LXL04_024675 · OH-1004

Plastid0.189

Rank 4 · LXL04_024675 · OH-1004

Lysosome / Vacuole0.068

Rank 5 · LXL04_024675 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141.29peroxidase20-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024675	`PF00141.29`	peroxidase	20	228	8.1e-50	170.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42564`	Arabidopsis thaliana	L-ascorbate peroxidase 3	77.622%	Swiss-Prot	strong database homology
`Q7XZP5`	Arabidopsis thaliana	L-ascorbate peroxidase 5, peroxisomal	70.290%	Swiss-Prot	strong database homology
`Q0JEQ2`	Oryza sativa subsp. japonica	Probable L-ascorbate peroxidase 3, peroxisomal	79.116%	Swiss-Prot	strong database homology
`Q01MI9`	Oryza sativa subsp. indica	Probable L-ascorbate peroxidase 3	78.715%	Swiss-Prot	strong database homology
`Q6ZJJ1`	Oryza sativa subsp. japonica	Probable L-ascorbate peroxidase 4, peroxisomal	73.540%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card