TkA08G053600 | RubberDandelionOmics

Gene overview

TkA08G053600

Reference: TK1151 Chr: Chr08 Coordinates: 13716738-13718310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1073 bp · TkA08G053600|TK1151|cDNA

TCCCCTGTCTCTCAAATCTACCTCGCCCATACCTCTTCAATCGCACGCCTCTATCACCTACCCTCTCTATCCCTGGTTAGAAGATATTGTCTCCATCCCTCTCATTTCTATCCTATATTTCCGGTTCAGAGGAGCAAACAATGGAAATTATCACGCTTTGATTTGGAGAAATCAGAAAAAATCCCCCTGGTTCAAGCTTTTCCATTCTCTCTCGATGTTATGCTAGAGGCATTGATTCCTAATCGAGAGACCACATCAGG...

CDS

Download CDS FASTA

681 bp · TkA08G053600|TK1151|CDS

TCCCCTGTCTCTCAAATCTACCTCGCCCATACCTCTTCAATCGCACGCCTCTATCACCTACCCTCTCTATCCCTGGTTAGAAGATATTGTCTCCATCCCTCTCATTTCTATCCTATATTTCCGGTTCAGAGGAGCAAACAATGGAAATTATCACGCTTTGATTTGGAGAAATCAGAAAAAATCCCCCTGGTTCAAGCTTTTCCATTCTCTCTCGATGTTATGCTAGAGGCATTGATTCCTAATCGAGAGACCACATCAGG...

Protein

Download Protein FASTA

226 aa · TkA08G053600|TK1151|PROTEIN

SPVSQIYLAHTSSIARLYHLPSLSLVRRYCLHPSHFYPIFPVQRSKQWKLSRFDLEKSEKIPLVQAFPFSLDVMLEALIPNRETTSGNQVPHASRTTATACTPPPPLSGGLLNFRRFRRRGNRIAGLWFVLRLKILRLTRLESINLQTLLDLLSALERGMLFWMNTVPQRLSTMELQSPELLSFLTPWKTLVLLLSERLQARATTQLVMVQQPHQFSFVKSSNSVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053600`
TK1151 ID	TkA08G053600
OH-1004 ID	LXL04_020255
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 22.566 / OH-1004 5.562 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053600

Location Chr08:13716738-13718310 (-)

Description Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28000`	Binds RuBisCO small and large subunits and is implicated in the assembly of the enzyme oligomer.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0042026 protein refolding Biological Process

GO:0050821 protein stabilization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

KEGG gene cross-reference

ath:AT2G28000

bna:106352579

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.362

Rank 1 · TkA08G053600 · TK1151

Cytoplasm0.344

Rank 2 · TkA08G053600 · TK1151

Mitochondrion0.239

Rank 3 · TkA08G053600 · TK1151

Cell membrane0.072

Rank 4 · TkA08G053600 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA08G053600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P21238`	Arabidopsis thaliana	sp\|P21238\|CPNA1_ARATH Chaperonin 60 subunit alpha 1, chloroplastic	89.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card