TkA08G053210 | RubberDandelionOmics

Gene overview

TkA08G053210

Reference: TK1151 Chr: Chr08 Coordinates: 13615265-13617613 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1090 bp · TkA08G053210|TK1151|cDNA

CCACAAAGTATAGAAAAAGCATCACTATAAATAACCTCCACCAACGCTTTAACACACTTGCAACACGATAAAAACTACTCAAATTCTAGAGAGAGAAAATCAAACAAATATGGGGCAAGAAGAGGAAACAATGCGAAAAGGTCCATGGACGGAACACGAAGATTATCAGTTAGTATTATACGTTCATATGTTTGGAGATCGCCGATGGGACTTCATTGCAAATGTTTCAGGTTTGAAAAGAACAGGAAAGAGTTGCAGAT...

CDS

Download CDS FASTA

804 bp · TkA08G053210|TK1151|CDS

ATGGGGCAAGAAGAGGAAACAATGCGAAAAGGTCCATGGACGGAACACGAAGATTATCAGTTAGTATTATACGTTCATATGTTTGGAGATCGCCGATGGGACTTCATTGCAAATGTTTCAGGTTTGAAAAGAACAGGAAAGAGTTGCAGATTGAGATGGGTTAATTATCTGCATCCAGGTCTCAAAAGAGGAAAGATGGCACCTCATGAAGAGCGGCTGGTTCTTGAACTTCATTCTAAATTTGGCAACAGGTGGTCGAA...

Protein

Download Protein FASTA

267 aa · TkA08G053210|TK1151|PROTEIN

MGQEEETMRKGPWTEHEDYQLVLYVHMFGDRRWDFIANVSGLKRTGKSCRLRWVNYLHPGLKRGKMAPHEERLVLELHSKFGNRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKRTASYRSPSPSFSHCSSSSSTICTSSNPTIDSMPMIQTKERSFYDTGGVVTKGKNNNNNNKVKKAARVCDSSDHGEDGYCSMDDIWKDIDLLEDDDSIIKPVFDPYSEIPPSLAWENYCSSGTSWIFNGQEEFGKDMITLTSQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053210`
TK1151 ID	TkA08G053210
OH-1004 ID	LXL04_036466
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.600
Protein coverage (%)	TK1151 95.131 / OH-1004 96.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053210

Location Chr08:13615265-13617613 (+)

Description Similar to MYB48: Transcription factor MYB48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46130`	Transcription factor.	No verified direct reference in this release
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At3g53200`	Transcription factor MYB27.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0567300`	Transcription factor.	No verified direct reference in this release
`Os11g0700500`	Transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036466 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0035865 cellular response to potassium ion Biological Process

GO:0043266 regulation of potassium ion transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G46130

ath:AT3G53200

ath:AT5G59780

dosa:Os11g0700500

dosa:Os12g0567300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA08G053210 · TK1151

Cytoplasm0.090

Rank 2 · TkA08G053210 · TK1151

Cell membrane0.023

Rank 3 · TkA08G053210 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G053210 · TK1151

Plastid0.010

Rank 5 · TkA08G053210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_79-29 aa

PF00249Myb_DNA-binding10-57 aa

PF13921Myb_DNA-bind_613-71 aa

PF23082Myb_DNA-binding_213-40 aa

PF12447DUF368313-51 aa

PF00249Myb_DNA-binding63-107 aa

PF13921Myb_DNA-bind_669-116 aa

PF15963Myb_DNA-bind_779-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G053210	`PF15963`	Myb_DNA-bind_7	9	29	0.1	13.1
TkA08G053210	`PF00249`	Myb_DNA-binding	10	57	3.3e-33	114.2
TkA08G053210	`PF13921`	Myb_DNA-bind_6	13	71	3.2e-19	69.6
TkA08G053210	`PF23082`	Myb_DNA-binding_2	13	40	0.015	16.0
TkA08G053210	`PF12447`	DUF3683	13	51	0.025	15.4
TkA08G053210	`PF00249`	Myb_DNA-binding	63	107	3.3e-33	114.2
TkA08G053210	`PF13921`	Myb_DNA-bind_6	69	116	3.2e-19	69.6
TkA08G053210	`PF15963`	Myb_DNA-bind_7	79	124	0.1	13.1
TkA08G053210	`PF30675`	FAM133	80	136	3.0	8.8
TkA08G053210	`PF23082`	Myb_DNA-binding_2	83	118	0.015	16.0
TkA08G053210	`PF07125`	DUF1378	99	116	0.2	12.5
TkA08G053210	`PF15157`	IQCJ-SCHIP1	100	143	0.0058	17.6
TkA08G053210	`PF10500`	SR-25	106	180	0.016	15.5
TkA08G053210	`PF30675`	FAM133	168	189	3.0	8.8
TkA08G053210	`PF15157`	IQCJ-SCHIP1	207	237	0.0058	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX82`	Arabidopsis thaliana	sp\|Q9LX82\|MYB48_ARATH Transcription factor MYB48	54.200%	Swiss-Prot	High
`Q4JL84`	Arabidopsis thaliana	sp\|Q4JL84\|MYB59_ARATH Transcription factor MYB59	50.000%	Swiss-Prot	High
`Q9SCP1`	Arabidopsis thaliana	sp\|Q9SCP1\|MYB27_ARATH Transcription factor MYB27	68.200%	Swiss-Prot	Low
`Q4JL76`	Oryza sativa subsp. japonica	sp\|Q4JL76\|MYBA2_ORYSJ Myb-related protein MYBAS2	52.700%	Swiss-Prot	High
`Q53NK6`	Oryza sativa subsp. japonica	sp\|Q53NK6\|MYBA1_ORYSJ Myb-related protein MYBAS1	56.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card