LXL04_036466 | RubberDandelionOmics

Gene overview

LXL04_036466

Reference: OH-1004 Chr: Chr08 Coordinates: 42664613-42666531 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_036466|LXL04_036466|OH1004|cDNA

ATGGGACAAGATCAAGATGatatgatgatgatgatgatgacaAGAAAAGGGCCATGGACTGAACAAGAAGATGTCCAATTGATTTCATTTGTGAACATGTTTGGAGATCGACGATGGGATTTCATAGCAAAAGTTTCAGGTTTAAAAAGAAGTGGAAAGAGTTGCAGATTGAGATGGGTAAACTACCTACACCCAGGTCTAAAAAGAGGCAAGATGACTCCTCAAGAAGAACGTCGAATAGTCGAGCTTCACTCTAAATG...

CDS

Download CDS FASTA

798 bp · LXL04_036466|LXL04_036466|OH1004|CDS

ATGGGACAAGATCAAGATGATATGATGATGATGATGATGACAAGAAAAGGGCCATGGACTGAACAAGAAGATGTCCAATTGATTTCATTTGTGAACATGTTTGGAGATCGACGATGGGATTTCATAGCAAAAGTTTCAGGTTTAAAAAGAAGTGGAAAGAGTTGCAGATTGAGATGGGTAAACTACCTACACCCAGGTCTAAAAAGAGGCAAGATGACTCCTCAAGAAGAACGTCGAATAGTCGAGCTTCACTCTAAATG...

Protein

Download Protein FASTA

265 aa · LXL04_036466|LXL04_036466|OH1004|PROTEIN

MGQDQDDMMMMMMTRKGPWTEQEDVQLISFVNMFGDRRWDFIAKVSGLKRSGKSCRLRWVNYLHPGLKRGKMTPQEERRIVELHSKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKEAQEKKRALSPSSSLSDFSSHSSICTNNPTFDSINPMMETDEKNFYDTGGLEMLIITNSRSSNTSPIKSIDATATSVNSSEGDDGYTSMDEIWKNIDSLEKDGIRPMFDTSNEMTPLPIWDYSLNTLWMMDGHEEIGSNMFFPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036466`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036466

Location Chr08:42664613-42666531 (+)

Description Similar to MYB48: Transcription factor MYB48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46130`	Transcription factor.	No verified direct reference in this release
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At3g53200`	Transcription factor MYB27.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0700500`	Transcription factor.	No verified direct reference in this release
`Os12g0567300`	Transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036466 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0035865 cellular response to potassium ion Biological Process

GO:0043266 regulation of potassium ion transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G46130

ath:AT3G53200

ath:AT5G59780

dosa:Os11g0700500

dosa:Os12g0567300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_036466 · OH-1004

Cytoplasm0.138

Rank 2 · LXL04_036466 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_036466 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_036466 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_036466 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding16-63 aa

PF13921.13Myb_DNA-bind_619-79 aa

PF00249.38Myb_DNA-binding69-113 aa

PF13921.13Myb_DNA-bind_673-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036466	`PF00249.38`	Myb_DNA-binding	16	63	9.2e-37	125.6
LXL04_036466	`PF13921.13`	Myb_DNA-bind_6	19	79	7e-20	71.7
LXL04_036466	`PF00249.38`	Myb_DNA-binding	69	113	9.2e-37	125.6
LXL04_036466	`PF13921.13`	Myb_DNA-bind_6	73	118	7e-20	71.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX82`	Arabidopsis thaliana	Transcription factor MYB48	51.908%	Swiss-Prot	strong database homology
`Q4JL84`	Arabidopsis thaliana	Transcription factor MYB59	53.061%	Swiss-Prot	strong database homology
`Q9SCP1`	Arabidopsis thaliana	Transcription factor MYB27	68.224%	Swiss-Prot	weak database homology
`Q53NK6`	Oryza sativa subsp. japonica	Myb-related protein MYBAS1	49.796%	Swiss-Prot	moderate database homology
`Q4JL76`	Oryza sativa subsp. japonica	Myb-related protein MYBAS2	52.790%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card