TkA08G051340 | RubberDandelionOmics

Gene overview

TkA08G051340

Reference: TK1151 Chr: Chr08 Coordinates: 13105840-13106276 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA08G051340|TK1151|cDNA

ATGTGGGGCCATGCATCTTCAAAACCAAAACCCGACCCTATTCCTGTTTCTAATGGTTGGTTATTTCATCTGAAATCAGATGCACAGGTTATTGCTGATGAGATGATGGAAAATGTAAGCAGTGATGATGAAGATGAACAAATGAACTTCAAAAGAGGGTCTAATGGTGAAGGGAATAACAGAAAAAGGAGGGTTGTTTTTGACAACTCTGATCATGATGATGATGAAGAAAAAGATATGGTGGTGAGTTTATCTTCACC...

CDS

Download CDS FASTA

381 bp · TkA08G051340|TK1151|CDS

ATGTGGGGCCATGCATCTTCAAAACCAAAACCCGACCCTATTCCTGTTTCTAATGGTTGGTTATTTCATCTGAAATCAGATGCACAGGTTATTGCTGATGAGATGATGGAAAATGTAAGCAGTGATGATGAAGATGAACAAATGAACTTCAAAAGAGGGTCTAATGGTGAAGGGAATAACAGAAAAAGGAGGGTTGTTTTTGACAACTCTGATCATGATGATGATGAAGAAAAAGATATGGTGGTGAGTTTATCTTCACC...

Protein

Download Protein FASTA

126 aa · TkA08G051340|TK1151|PROTEIN

MWGHASSKPKPDPIPVSNGWLFHLKSDAQVIADEMMENVSSDDEDEQMNFKRGSNGEGNNRKRRVVFDNSDHDDDEEKDMVVSLSSPDPPKKQVSVDLKRSGKIDSSLENKNLDFDEKKRRESEGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G051340`
TK1151 ID	TkA08G051340
OH-1004 ID	LXL04_037775
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.400
Protein coverage (%)	TK1151 94.444 / OH-1004 23.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G051340`
Location	Chr08:13105840-13106276 (+)
Description	Similar to POLD3: DNA polymerase delta subunit 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037775` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000731 DNA synthesis involved in DNA repair Biological Process GO:0006260 DNA replication Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006271 DNA strand elongation involved in DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006297 nucleotide-excision repair, DNA gap filling Biological Process GO:0006298 mismatch repair Biological Process GO:0042276 error-prone translesion synthesis Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:1904161 DNA synthesis involved in UV-damage excision repair Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	gga:419053 hsa:10714 mmu:67967 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA08G051340 · TK1151

Cytoplasm0.113

Rank 2 · TkA08G051340 · TK1151

Cell membrane0.030

Rank 3 · TkA08G051340 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA08G051340 · TK1151

Plastid0.011

Rank 5 · TkA08G051340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18849baeRF_family729-82 aa

PF09148DUF193438-121 aa

PF09598Stm1_N73-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G051340	`PF18849`	baeRF_family7	29	82	0.077	13.9
TkA08G051340	`PF09148`	DUF1934	38	121	0.013	16.2
TkA08G051340	`PF09598`	Stm1_N	73	118	0.085	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card