Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1437 bp · LXL04_037775|LXL04_037775|OH1004|cDNA
ATGGCCGATATCGAAACCCTAGGTATTCTAGATGAGATTCAAGCACTCGTCTCCGATAAGCTTCAAGTGGTTTCTTACAAGTGGCTGAGTCGAAACTTTTTGGTGCCATCAAATACTGCTAAGAGACTCCTTGAAGATTTTGTGAAAAATAACGAATCTCAACTGGAGGTTATATATTCTTTATCCGGATGGTTGAAGAATAATCCTTCAGCTTACCATATAAAGCTTGTTACGACCTCCAAACTTCCAGAAGCCAAAGA...
1437 bp · LXL04_037775|LXL04_037775|OH1004|CDS
ATGGCCGATATCGAAACCCTAGGTATTCTAGATGAGATTCAAGCACTCGTCTCCGATAAGCTTCAAGTGGTTTCTTACAAGTGGCTGAGTCGAAACTTTTTGGTGCCATCAAATACTGCTAAGAGACTCCTTGAAGATTTTGTGAAAAATAACGAATCTCAACTGGAGGTTATATATTCTTTATCCGGATGGTTGAAGAATAATCCTTCAGCTTACCATATAAAGCTTGTTACGACCTCCAAACTTCCAGAAGCCAAAGA...
Protein
Download Protein FASTA478 aa · LXL04_037775|LXL04_037775|OH1004|PROTEIN
MADIETLGILDEIQALVSDKLQVVSYKWLSRNFLVPSNTAKRLLEDFVKNNESQLEVIYSLSGWLKNNPSAYHIKLVTTSKLPEAKEEFGDDCSVQVYSVQACVPKDPSVIWNTEFIQTEELFKEPPNVINCLRDNRFCGVSNSYVKRNTEGTPVIKTPTFQEKKAEQSNPKPEKVKDVLNGSHRAQVLEQKEVKPVPHKEKQPQIPNKKKPQNDKTSSSNSGSLASMWGRASSKPKPDPIPVSNADAQVIADEMMENVS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037775 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037775 |
|---|---|
| Location | Chr09:20876250-20878663 (-) |
| Description | Similar to POLD3: DNA polymerase delta subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000731 DNA synthesis involved in DNA repair Biological Process GO:0006260 DNA replication Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006271 DNA strand elongation involved in DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006297 nucleotide-excision repair, DNA gap filling Biological Process GO:0006298 mismatch repair Biological Process GO:0042276 error-prone translesion synthesis Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:1904161 DNA synthesis involved in UV-damage excision repair Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component |
| KEGG gene cross-reference | gga:419053 hsa:10714 mmu:67967 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09507.17CDC2723-478 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037775 | PF09507.17 | CDC27 | 23 | 478 | 5e-23 | 83.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.