TkA08G026480 | RubberDandelionOmics

Gene overview

TkA08G026480

Reference: TK1151 Chr: Chr08 Coordinates: 6833734-6834494 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

644 bp · TkA08G026480|TK1151|cDNA

CACACATGTATAAATATGCTTTTTCCCCAAATTAAATCATACAGACCCTAAAAACGTAAAGCCCTAGAAATTTCAAGAAGGCGAAAATGGCGAGACCTGCGAGACAATTGGCAGCGTCGTCAATGACAACAACCACCGCTACGATAACCCTAGATAACCCAACTCCGGCGCAGACAACAACTCTAACATTGACGCTCAATCCAAGGAAGAAGAAGGTGACATGGAAAGAAGGTACCGTCGATAACGAGTTTCTCCAAAAG...

CDS

Download CDS FASTA

315 bp · TkA08G026480|TK1151|CDS

ATGGCGAGACCTGCGAGACAATTGGCAGCGTCGTCAATGACAACAACCACCGCTACGATAACCCTAGATAACCCAACTCCGGCGCAGACAACAACTCTAACATTGACGCTCAATCCAAGGAAGAAGAAGGTGACATGGAAAGAAGGTACCGTCGATAACGAGTTTCTCCAAAAGAAGAGCTCAAAAAAATGCTGCATCTTCCATAAACAAAAATCTTTCGACGAAGATTCAAGCGACGACGAGGATTGTCACGATCATGA...

Protein

Download Protein FASTA

104 aa · TkA08G026480|TK1151|PROTEIN

MARPARQLAASSMTTTTATITLDNPTPAQTTTLTLTLNPRKKKVTWKEGTVDNEFLQKKSSKKCCIFHKQKSFDEDSSDDEDCHDHDHDHGCGESKKDDGASTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G026480`
TK1151 ID	TkA08G026480
OH-1004 ID	LXL04_018107
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G026480`
Location	Chr08:6833734-6834494 (-)
Description	Similar to INH3: Protein phosphatase 1 regulatory subunit INH3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018107` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001818 negative regulation of cytokine production Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0016567 protein ubiquitination Biological Process GO:0050830 defense response to Gram-positive bacterium Biological Process GO:0000164 protein phosphatase type 1 complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0004864 protein phosphatase inhibitor activity Molecular Function GO:0004865 protein serine/threonine phosphatase inhibitor activity Molecular Function GO:0008157 protein phosphatase 1 binding Molecular Function
KEGG gene cross-reference	ath:AT2G31305 cal:CAALFM_C114350WA dre:550290 lel:PVL30_003122 spo:2543302 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.544

Rank 1 · TkA08G026480 · TK1151

Nucleus0.370

Rank 2 · TkA08G026480 · TK1151

Cell membrane0.211

Rank 3 · TkA08G026480 · TK1151

Mitochondrion0.065

Rank 4 · TkA08G026480 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA08G026480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16862Glyco_hydro_79C11-62 aa

PF07491PPI_Ypi138-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G026480	`PF16862`	Glyco_hydro_79C	11	62	0.14	13.7
TkA08G026480	`PF07491`	PPI_Ypi1	38	82	7.3e-20	71.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card