TkA08G023540 | RubberDandelionOmics

Gene overview

TkA08G023540

Reference: TK1151 Chr: Chr08 Coordinates: 5986198-5990614 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2545 bp · TkA08G023540|TK1151|cDNA

AAAAAGAGGCTTTTTATTTCTTTTAATAAAAATCTGAAGACAAAAACCCTTGAGAGAAAGTAGGGGGGTTTTGATGAGTGAAATAGTAAAGTAATTTGATTCCTTGTATTATTTATTGAAAGCCATTCTATTTGTTCTGGCAAAGTTCCCATGATTGTCCATTCGCGTTGAGAGCTCTCTTCCAAGTCACTATCTTGTGTTTCTCTTTCTAAGATCCGCTTTCTCTCTCTAAAATCTTTGAGTTTGTTCGTATCGTTTCG...

CDS

Download CDS FASTA

1893 bp · TkA08G023540|TK1151|CDS

ATGACAGTTGAGGAAATTAGAGGGGGTGTTTTGGGTAATGAAATCGACAGGTTTCCCATTGGGATGAGAGTTCTTGCTGTTGACGATGATCCAACTTGCTTGAAATTATTGGATGGACTTCTAAGAAAATGCCAATATCAAGTTACAACTACAAATCAAGCAATTACAGCATTGAAGATGTTAAGGGAAAACAGAAACAGATTCGATTTGATCATTAGCGATGTTTATATGCCAGACATGGATGGTTTCAAGCTACTTGA...

Protein

Download Protein FASTA

630 aa · TkA08G023540|TK1151|PROTEIN

MTVEEIRGGVLGNEIDRFPIGMRVLAVDDDPTCLKLLDGLLRKCQYQVTTTNQAITALKMLRENRNRFDLIISDVYMPDMDGFKLLELVGLEMDLPVIMLSGNSDPKLVMKGITHGACDYLVKPVRLEELRNIWQHVIRRKVESKSQSKSKSNNDHDNNSDQGHENEDQNVKVNRKRGIEDEDVEENGHESDDPSAQKKPRVVWSIDLHRKFVAAVNQLGIEKAVPKRILDLMNVEGITRENVASHLQKYRLYLKRISHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G023540`
TK1151 ID	TkA08G023540
OH-1004 ID	LXL04_002792
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.300
Protein coverage (%)	TK1151 99.048 / OH-1004 99.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G023540

Location Chr08:5986198-5990614 (+)

Description Similar to RR22: Two-component response regulator ORR22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25180`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.	The rate of cell differentiation controls the Arabidopsis root meristem growth phase.2010 · DOI: 10.1016/j.cub.2010.05.035

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B3I4`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os06g0183100`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`UniProt: A2X1N2`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release
`Os02g0182100`	Transcriptional activator that binds specific DNA sequence.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002792 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0182100

dosa:Os02g0796500

dosa:Os06g0183100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA08G023540 · TK1151

Cytoplasm0.072

Rank 2 · TkA08G023540 · TK1151

Cell membrane0.026

Rank 3 · TkA08G023540 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA08G023540 · TK1151

Plastid0.013

Rank 5 · TkA08G023540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00072Response_reg24-133 aa

PF04931DNA_pol_phi98-195 aa

PF00249Myb_DNA-binding201-251 aa

PF00249Myb_DNA-binding359-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G023540	`PF00072`	Response_reg	24	133	6.4e-24	85.0
TkA08G023540	`PF04931`	DNA_pol_phi	98	195	0.022	13.7
TkA08G023540	`PF00249`	Myb_DNA-binding	201	251	2.1e-06	28.5
TkA08G023540	`PF00249`	Myb_DNA-binding	359	367	2.1e-06	28.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P62598`	Arabidopsis thaliana	sp\|P62598\|ARR12_ARATH Two-component response regulator ARR12	58.600%	Swiss-Prot	Medium
`B8B3I4`	Oryza sativa subsp. indica	sp\|B8B3I4\|ORR22_ORYSI Two-component response regulator ORR22	57.900%	Swiss-Prot	Medium
`Q5SML5`	Oryza sativa subsp. japonica	sp\|Q5SML5\|ORR22_ORYSJ Two-component response regulator ORR22	57.900%	Swiss-Prot	Medium
`A2X1N2`	Oryza sativa subsp. indica	sp\|A2X1N2\|ORR24_ORYSI Two-component response regulator ORR24	56.100%	Swiss-Prot	Medium
`Q6H805`	Oryza sativa subsp. japonica	sp\|Q6H805\|ORR24_ORYSJ Two-component response regulator ORR24	56.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card