TkA08G020840 | RubberDandelionOmics

Gene overview

TkA08G020840

Reference: TK1151 Chr: Chr08 Coordinates: 5222122-5222931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA08G020840|TK1151|cDNA

CTTACCAGACTTGAAGGCAAAGTAGCTCTGATTACCGGAGCAGCAAGCGGCATCGGCAAAGAAACTGCAACCAAGTTCATCAACCACGGCGCCAAGGTGGTGATCGCCGACATCCATCACAACCTCGGCCAGAACACCGCCACACAACTCGGGCCCAATGCCTCCTTCATCTCCTGCAACGTCACCAACGACTCCGACATCGCCAAAGCAGTCGACTTCACCGTATCCAAATACGGAAAACTCGACATCATGTACAACAA...

CDS

Download CDS FASTA

780 bp · TkA08G020840|TK1151|CDS

CTTACCAGACTTGAAGGCAAAGTAGCTCTGATTACCGGAGCAGCAAGCGGCATCGGCAAAGAAACTGCAACCAAGTTCATCAACCACGGCGCCAAGGTGGTGATCGCCGACATCCATCACAACCTCGGCCAGAACACCGCCACACAACTCGGGCCCAATGCCTCCTTCATCTCCTGCAACGTCACCAACGACTCCGACATCGCCAAAGCAGTCGACTTCACCGTATCCAAATACGGAAAACTCGACATCATGTACAACAA...

Protein

Download Protein FASTA

259 aa · TkA08G020840|TK1151|PROTEIN

LTRLEGKVALITGAASGIGKETATKFINHGAKVVIADIHHNLGQNTATQLGPNASFISCNVTNDSDIAKAVDFTVSKYGKLDIMYNNAGSPFQTPPTILDLNLDTFDHVMSVNVRGVLAGIKHACRVMIPRETGSILCTASVTGVLGGLGQHTYSISKFAVVGIVKSLASELSQHGVRINCISPFAIPTTLDLKEEEITSMVQNAGEFKGSYCEPGDVADAAVYLASDEAKYVSGQNLVVDGGFTSVKSFKFTVPQKEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G020840`
TK1151 ID	TkA08G020840
OH-1004 ID	LXL04_037023
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 98.842 / OH-1004 89.262 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G020840

Location Chr08:5222122-5222931 (+)

Description Similar to Secoisolariciresinol dehydrogenase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47130`	Confers resistance to the incompatible pathogenic bacteria P.syringae pv. tomato DC3000 in a PR1-dependent manner.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037023 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009807 lignan biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010301 xanthoxin dehydrogenase (NAD+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0102069 zerumbone synthase activity Molecular Function

GO:0120529 secoisolariciresinol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:BAK09296

ath:AT2G47130

ath:AT3G51680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.754

Rank 1 · TkA08G020840 · TK1151

Nucleus0.369

Rank 2 · TkA08G020840 · TK1151

Peroxisome0.088

Rank 3 · TkA08G020840 · TK1151

Mitochondrion0.066

Rank 4 · TkA08G020840 · TK1151

Plastid0.035

Rank 5 · TkA08G020840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short7-192 aa

PF08659KR9-159 aa

PF01370Epimerase9-72 aa

PF13561adh_short_C213-245 aa

PF13460NAD_binding_1013-72 aa

PF01370Epimerase153-182 aa

PF13840ACT_7158-183 aa

PF08659KR166-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G020840	`PF00106`	adh_short	7	192	7.8e-49	166.5
TkA08G020840	`PF08659`	KR	9	159	7.3e-10	39.8
TkA08G020840	`PF01370`	Epimerase	9	72	0.00053	20.2
TkA08G020840	`PF13561`	adh_short_C2	13	245	9.1e-59	199.6
TkA08G020840	`PF13460`	NAD_binding_10	13	72	0.088	13.4
TkA08G020840	`PF01370`	Epimerase	153	182	0.00053	20.2
TkA08G020840	`PF13840`	ACT_7	158	183	0.041	14.5
TkA08G020840	`PF08659`	KR	166	183	7.3e-10	39.8
TkA08G020840	`PF13460`	NAD_binding_10	190	228	0.088	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80713`	Arabidopsis thaliana	sp\|O80713\|SDR3A_ARATH Short-chain dehydrogenase reductase 3a	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card