TkA08G020690 | RubberDandelionOmics

Gene overview

TkA08G020690

Reference: TK1151 Chr: Chr08 Coordinates: 5175061-5177385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1654 bp · TkA08G020690|TK1151|cDNA

CCTACCTTTTCTCCGTGAAAATTCTCCAATCCCAGTTCCGATTCCGACTCTCACGGCCGATGTTACAACGCCATCGATGGATTCCTTAATCACATTCCTATCTCCTCCATTCATGGAATCCAAAATTCCTCCTCCACAGGTCCACTTTCTCCAAATCGATTGATCTATGTTTATTACGAATAGGAAGAATCCCCTTTGATCTCCAACACTATTTGATACGAAAGCTTCAATCTTTTTCAATTCCTGCCGGAGAAAAAGAA...

CDS

Download CDS FASTA

858 bp · TkA08G020690|TK1151|CDS

ATGGCGACATTGGAGGTGAAACTTATACAAGGACACGCTCTGACTAATAAAGATCTTATTGGAAAATCTGATCCTTATGCTAAGATGTATTTAGGCCCTGAGCGTGGTAAAACGCAAAGCAGCAAAATTATTGACAATGATTTGAACCCAATATGGAATGAACATTTCGAGTTTGTAGTTGAAGATACTTCCACCCAACACTTGACGGTAGAAATATACGATGATGATGGTCTTCAGGCTTCAGAACTCATTGGATGTGC...

Protein

Download Protein FASTA

285 aa · TkA08G020690|TK1151|PROTEIN

MATLEVKLIQGHALTNKDLIGKSDPYAKMYLGPERGKTQSSKIIDNDLNPIWNEHFEFVVEDTSTQHLTVEIYDDDGLQASELIGCAQVKLDELEPGVVKDVWLKLVENLETPKEDEDQGHVRLELLYCPNGVREMFLKEDPGGENGDVLDKKKRIVIRGVLSVTVMSAEDLPPADLSGKADPFVVLTMKKTLTKHKTSVVYQNLNPTWNETFDFVVEDGIRDMLIANIWDHDTFGKDFMGRSIVTLTRVLLEGEYEGSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G020690`
TK1151 ID	TkA08G020690
OH-1004 ID	LXL04_018200
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 47.659 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G020690

Location Chr08:5175061-5177385 (+)

Description Similar to SYT5: Synaptotagmin-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05500`	May be involved in membrane trafficking.	No verified direct reference in this release
`At5g11100`	May be involved in membrane trafficking.	No verified direct reference in this release
`At3g61050`	May be involved in membrane trafficking (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018200 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0033011 perinuclear theca Cellular Component

GO:0008289 lipid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05500

ath:AT5G11100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.493

Rank 1 · TkA08G020690 · TK1151

Cell membrane0.390

Rank 2 · TkA08G020690 · TK1151

Nucleus0.210

Rank 3 · TkA08G020690 · TK1151

Golgi apparatus0.099

Rank 4 · TkA08G020690 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA08G020690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C23-106 aa

PF07162B9-C232-91 aa

PF14429DOCK-C239-89 aa

PF10651BppU_N46-76 aa

PF21494PKC_C248-61 aa

PF00168C2160-261 aa

PF10651BppU_N162-201 aa

PF21494PKC_C2177-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G020690	`PF00168`	C2	3	106	2.4e-53	179.5
TkA08G020690	`PF07162`	B9-C2	32	91	0.033	15.0
TkA08G020690	`PF14429`	DOCK-C2	39	89	0.035	14.7
TkA08G020690	`PF10651`	BppU_N	46	76	0.12	12.7
TkA08G020690	`PF21494`	PKC_C2	48	61	0.036	15.0
TkA08G020690	`PF00168`	C2	160	261	2.4e-53	179.5
TkA08G020690	`PF10651`	BppU_N	162	201	0.12	12.7
TkA08G020690	`PF21494`	PKC_C2	177	220	0.036	15.0
TkA08G020690	`PF14429`	DOCK-C2	190	213	0.035	14.7
TkA08G020690	`PF10651`	BppU_N	211	237	0.12	12.7
TkA08G020690	`PF07162`	B9-C2	226	238	0.033	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L706`	Arabidopsis thaliana	sp\|Q8L706\|SYT5_ARATH Synaptotagmin-5	59.900%	Swiss-Prot	High
`A0JJX5`	Arabidopsis thaliana	sp\|A0JJX5\|SYT4_ARATH Synaptotagmin-4	54.200%	Swiss-Prot	High
`Q9LEX1`	Arabidopsis thaliana	sp\|Q9LEX1\|CLB_ARATH Calcium-dependent lipid-binding protein	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card