TkA08G017180 | RubberDandelionOmics

Gene overview

TkA08G017180

Reference: TK1151 Chr: Chr08 Coordinates: 4269655-4270614 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · TkA08G017180|TK1151|cDNA

GTACACCAGTACACCACCCTCTCCCGTAAAACTTCAACCTCCAACACCATATAAACCCCCACCACCCTCCGCCACACTTGTAAACTCCCACGCTCAAAGAAATGGCTTCCGCTTCCGCTGCCCATGCGATCTTACATCTTTTCTGGTTCTCTTTCATGGCCGTCGCCGCCGTCACTTCTGCCGTTGGTACTACCGAGTTCCCAGTTGGGGGCGACGTCGGTTGGCGAATCCCTGCAACCAATGAAACCGAACTCTACAAT...

CDS

Download CDS FASTA

615 bp · TkA08G017180|TK1151|CDS

ATGGCTTCCGCTTCCGCTGCCCATGCGATCTTACATCTTTTCTGGTTCTCTTTCATGGCCGTCGCCGCCGTCACTTCTGCCGTTGGTACTACCGAGTTCCCAGTTGGGGGCGACGTCGGTTGGCGAATCCCTGCAACCAATGAAACCGAACTCTACAATGTCTGGGCTTCCAGACGACGCTTCCACATCGGCGATTCCCTCCGTTTTCGTTACAAGAACGATTCAGTAGCGGTGGTTAAAAAATGGGGGTTCTACCACTG...

Protein

Download Protein FASTA

204 aa · TkA08G017180|TK1151|PROTEIN

MASASAAHAILHLFWFSFMAVAAVTSAVGTTEFPVGGDVGWRIPATNETELYNVWASRRRFHIGDSLRFRYKNDSVAVVKKWGFYHCDPSSPIAFFNDGDSLINLDNAGTMYFISGNSDRCKEGEKMMVEVIGSDLGSFFPPSIASPPESPYSAAAPSPSHFSGYGGSPANSPRYSSSNSAIRFPVSVSVIAFIVGLGLISLAI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G017180`
TK1151 ID	TkA08G017180
OH-1004 ID	LXL04_002117
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	96.800
Protein coverage (%)	TK1151 91.176 / OH-1004 87.324 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G017180

Location Chr08:4269655-4270614 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48940`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At4g27520`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At1g64640`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002117 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G48940

ath:AT1G79800

ath:AT3G18590

ath:AT5G53870

dosa:Os06g0553800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.777

Rank 1 · TkA08G017180 · TK1151

Endoplasmic reticulum0.098

Rank 2 · TkA08G017180 · TK1151

Extracellular0.081

Rank 3 · TkA08G017180 · TK1151

Cytoplasm0.065

Rank 4 · TkA08G017180 · TK1151

Nucleus0.042

Rank 5 · TkA08G017180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01284MARVEL7-40 aa

PF02298Cu_bind_like49-124 aa

PF01284MARVEL174-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G017180	`PF01284`	MARVEL	7	40	0.04	14.7
TkA08G017180	`PF02298`	Cu_bind_like	49	124	3.4e-20	72.5
TkA08G017180	`PF01284`	MARVEL	174	202	0.04	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4PSZ8`	Arabidopsis thaliana	sp\|Q4PSZ8\|ENL06_ARATH Early nodulin-like protein 6	41.400%	Swiss-Prot	Medium
`Q9T076`	Arabidopsis thaliana	sp\|Q9T076\|ENL02_ARATH Early nodulin-like protein 2	42.000%	Swiss-Prot	Medium
`Q6NLD7`	Arabidopsis thaliana	sp\|Q6NLD7\|ENL08_ARATH Early nodulin-like protein 8	36.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card