LXL04_002117 | RubberDandelionOmics

Gene overview

LXL04_002117

Reference: OH-1004 Chr: Chr01 Coordinates: 42048549-42050443 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_002117|LXL04_002117|OH1004|cDNA

GCTTCCGCTTCCGCTGCCCATGCGATCTTACATCTTTTCTGGTTCTCTTTCATGGCCGTCGCCGCCGTCACTTCTGCCGTTGGTACTACCGAGTTCCCAGTTGGGGGCGACGTCGGTTGGCGAATCCCTGCAACCAATGAAACCGAACTCTACAATGTCTGGGCTTCCAGACGACGCTTCCACATCGGCGATTCCCTCCGTTTTCGTTACAAGAATGATTCAGTAGCGGTGGTTAAAAAATGGGGGTTCTACCACTGCGA...

CDS

Download CDS FASTA

639 bp · LXL04_002117|LXL04_002117|OH1004|CDS

ATGGCCGTCGCCGCCGTCACTTCTGCCGTTGGTACTACCGAGTTCCCAGTTGGGGGCGACGTCGGTTGGCGAATCCCTGCAACCAATGAAACCGAACTCTACAATGTCTGGGCTTCCAGACGACGCTTCCACATCGGCGATTCCCTCCGTTTTCGTTACAAGAATGATTCAGTAGCGGTGGTTAAAAAATGGGGGTTCTACCACTGCGATCCTAGCTCTCCGATCGCTTTCTTCAACGACGGCGACTCCCTGATCAATCT...

Protein

Download Protein FASTA

213 aa · LXL04_002117|LXL04_002117|OH1004|PROTEIN

MAVAAVTSAVGTTEFPVGGDVGWRIPATNETELYNVWASRRRFHIGDSLRFRYKNDSVAVVKKWGFYHCDPSSPIAFFNDGDSLINLDNAGTMYFISGNSDRCKEGEKMMVEVIGSDLGSFFPPSIASPPESPYSAAAPSPSHFSGYGGSPANSPRYSSSNSAIRFPVSVSVIAFIVGLGLISLAIFGYLVSLNSHLLFLLSSTIPLSLQIFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002117`
TK1151 ID	TkA08G017180
OH-1004 ID	LXL04_002117
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	96.800
Protein coverage (%)	TK1151 91.176 / OH-1004 87.324 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002117

Location Chr01:42048549-42050443 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79800`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At1g48940`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At3g18590`	May act as a carbohydrate transporter.	No verified direct reference in this release
`At5g53870`	May act as a carbohydrate transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0553800`	May act as a carbohydrate transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002117 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

KEGG gene cross-reference

ath:AT1G48940

ath:AT1G79800

ath:AT3G18590

ath:AT5G53870

dosa:Os06g0553800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.683

Rank 1 · LXL04_002117 · OH-1004

Endoplasmic reticulum0.132

Rank 2 · LXL04_002117 · OH-1004

Extracellular0.096

Rank 3 · LXL04_002117 · OH-1004

Cytoplasm0.079

Rank 4 · LXL04_002117 · OH-1004

Nucleus0.070

Rank 5 · LXL04_002117 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298.24Cu_bind_like31-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002117	`PF02298.24`	Cu_bind_like	31	106	3.8e-20	72.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQN9`	Arabidopsis thaliana	Early nodulin-like protein 7	46.512%	Swiss-Prot	moderate database homology
`Q4PSZ8`	Arabidopsis thaliana	Early nodulin-like protein 6	43.636%	Swiss-Prot	moderate database homology
`Q9LII0`	Arabidopsis thaliana	Early nodulin-like protein 5	43.519%	Swiss-Prot	moderate database homology
`Q9FN39`	Arabidopsis thaliana	Early nodulin-like protein 1	40.994%	Swiss-Prot	moderate database homology
`Q5Z9C8`	Oryza sativa subsp. japonica	Early nodulin-like protein 17	45.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card