Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2317 bp · TkA08G016630|TK1151|cDNA
TTTCGATACATAAAAAAGAGTAAAATAAGCTTAAAAGTAAACTCACTCCTCTCTCTTTCCTCCCTCTCCCTCTCCCTCTCCCTCTTTCCAACACAACCCTACAAATTTCTCTCTCTATATACTAAACACTAAATGCAAGACACCAAAACAAGGCTGCAACTTTCTAACAAATGCTGACTGATTCTCTTTCTTTAAACTTAATTTGAAAGGCCACCATTACCAATTTACCATCATCATCATCATCATCCTCCTCCACATGC...
921 bp · TkA08G016630|TK1151|CDS
ATGGAAAGAGGGATTCAGCCTCCTTTGGTGGATACAACAGCTTGTTTATGTAGAGTAGACGTCGGTCTGAAAACCGTCGCCGGAGCAAAAAGATTCGTACCCGGTTCAAAGCTCTGTCTCCAGCCCGACATCAAAGCATCAATCCACCCAACCAGACCAAAACCACCGCGCGACAGAACCCGCAACCAATCCCCTCTCCTGCCCGGACTGCCCGACGACCTCGCAATCGCCTGCTTAATCCGCGTCCCAAGAATCGACCA...
Protein
Download Protein FASTA306 aa · TkA08G016630|TK1151|PROTEIN
MERGIQPPLVDTTACLCRVDVGLKTVAGAKRFVPGSKLCLQPDIKASIHPTRPKPPRDRTRNQSPLLPGLPDDLAIACLIRVPRIDHRKLRLVCKRWYRLLAGNFFYSLRKNLEISEEWVYVMKRDKDRKMHWHGFDPMNHLWQPLPPVPKEYTEAEGFGCAVLSGCHLYLFGGKDPIKGSMRRVVYYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSVEVYDPSKNRWCFVADMSTAMVPFIGV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G016630 |
|---|---|
| TK1151 ID | TkA08G016630 |
| OH-1004 ID | LXL04_018281 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 98.693 / OH-1004 71.596Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G016630 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:4094167-4096653 (+) | |||||||||
| Description | Similar to At1g55270: F-box/kelch-repeat protein At1g55270 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009585 red, far-red light phototransduction Biological Process GO:0010017 red or far-red light signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:2000762 regulation of phenylpropanoid metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G22040 ath:AT1G27420 ath:AT1G30090 ath:AT1G55270 ath:AT2G24540 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00646F-box68-104 aaPF12937F-box-like69-104 aaPF18511F-box_592-100 aaPF25210Kelch_FKB95117-164 aaPF24681Kelch_KLHDC2_KLHL20_DRC7130-292 aaPF07646Kelch_2131-150 aaPF13415Beta-prop_FBX42133-197 aaPF01344Kelch_1136-149 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G016630 | PF00646 | F-box | 68 | 104 | 2.8e-07 | 30.9 |
| TkA08G016630 | PF12937 | F-box-like | 69 | 104 | 0.00067 | 20.1 |
| TkA08G016630 | PF18511 | F-box_5 | 92 | 100 | 0.15 | 12.3 |
| TkA08G016630 | PF25210 | Kelch_FKB95 | 117 | 164 | 1.5e-16 | 61.5 |
| TkA08G016630 | PF24681 | Kelch_KLHDC2_KLHL20_DRC7 | 130 | 292 | 6.5e-12 | 45.9 |
| TkA08G016630 | PF07646 | Kelch_2 | 131 | 150 | 1.7e-09 | 37.9 |
| TkA08G016630 | PF13415 | Beta-prop_FBX42 | 133 | 197 | 2.7e-05 | 24.6 |
| TkA08G016630 | PF01344 | Kelch_1 | 136 | 149 | 4.9e-28 | 97.0 |
| TkA08G016630 | PF24996 | NANM | 141 | 197 | 0.069 | 12.7 |
| TkA08G016630 | PF13964 | Beta-prop_Calicin | 143 | 266 | 3.1e-12 | 46.8 |
| TkA08G016630 | PF25210 | Kelch_FKB95 | 155 | 297 | 1.5e-16 | 61.5 |
| TkA08G016630 | PF01344 | Kelch_1 | 161 | 201 | 4.9e-28 | 97.0 |
| TkA08G016630 | PF13854 | Kelch_HCF | 161 | 179 | 0.036 | 14.1 |
| TkA08G016630 | PF07646 | Kelch_2 | 169 | 201 | 1.7e-09 | 37.9 |
| TkA08G016630 | PF24981 | Beta-prop_ATRN-LZTR1 | 169 | 254 | 6.9e-05 | 23.0 |
| TkA08G016630 | PF13854 | Kelch_HCF | 202 | 248 | 0.036 | 14.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.