LXL04_018281 | RubberDandelionOmics

Gene overview

LXL04_018281

Reference: OH-1004 Chr: Chr04 Coordinates: 10265932-10267296 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_018281|LXL04_018281|OH1004|cDNA

ATGGAAAGAGGGATTCAGCCTCCTTTGGTGGATACAACAGCTTGTTTATGTAGAGTAGACGTCGGTCTGAAAACCGTCGCCGGAGCAAAAAGATTCGTACCCGGTTCAAAGCTCTGTCTCCAGCCCGACATCAAAGCATCAATCCACCCAACCAGACAAAAACCACCGCGCGACAGAACCCGCAACCAATCCCCTCTCCTGCCCGGACTGCCCGACGACCTCGCAATCGCCTGCTTAATCCGCGTCCCAAGAATCGACCA...

CDS

Download CDS FASTA

1281 bp · LXL04_018281|LXL04_018281|OH1004|CDS

ATGGAAAGAGGGATTCAGCCTCCTTTGGTGGATACAACAGCTTGTTTATGTAGAGTAGACGTCGGTCTGAAAACCGTCGCCGGAGCAAAAAGATTCGTACCCGGTTCAAAGCTCTGTCTCCAGCCCGACATCAAAGCATCAATCCACCCAACCAGACAAAAACCACCGCGCGACAGAACCCGCAACCAATCCCCTCTCCTGCCCGGACTGCCCGACGACCTCGCAATCGCCTGCTTAATCCGCGTCCCAAGAATCGACCA...

Protein

Download Protein FASTA

426 aa · LXL04_018281|LXL04_018281|OH1004|PROTEIN

MERGIQPPLVDTTACLCRVDVGLKTVAGAKRFVPGSKLCLQPDIKASIHPTRQKPPRDRTRNQSPLLPGLPDDLAIACLIRVPRIDHRKLRLVCKRWYRLLAGNFFYSLRKNLEISEEWVYVMKRDKDRKMHWHGFDPMNHLWQPLPPVPKEYTEAEGFGCAVLSGCHLYLFGGKDPIKGSMRRVVYYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVHRSLRSVEVYDPSKNRWCFVADMSTAMVPFIGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018281`
TK1151 ID	TkA08G016630
OH-1004 ID	LXL04_018281
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 98.693 / OH-1004 71.596 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018281

Location Chr04:10265932-10267296 (+)

Description Similar to At1g55270: F-box/kelch-repeat protein At1g55270

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55270`	F-box/kelch-repeat protein At1g55270.	No verified direct reference in this release
`At1g30090`	F-box/kelch-repeat protein At1g30090.	No verified direct reference in this release
`At1g22040`	F-box/kelch-repeat protein At1g22040.	No verified direct reference in this release
`At2g24540`	Component of SCF (ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At1g27420`	Putative F-box/kelch-repeat protein At1g27420.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G22040

ath:AT1G27420

ath:AT1G30090

ath:AT1G55270

ath:AT2G24540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.681

Rank 1 · LXL04_018281 · OH-1004

Cytoplasm0.231

Rank 2 · LXL04_018281 · OH-1004

Cell membrane0.085

Rank 3 · LXL04_018281 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_018281 · OH-1004

Plastid0.035

Rank 5 · LXL04_018281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box68-104 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7130-293 aa

PF13964.13Beta-prop_Calicin142-265 aa

PF25210.2Kelch_FKB95155-335 aa

PF01344.32Kelch_1161-201 aa

PF24981.2Beta-prop_ATRN-LZTR1169-247 aa

PF24981.2Beta-prop_ATRN-LZTR1169-252 aa

PF01344.32Kelch_1204-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018281	`PF00646.39`	F-box	68	104	3.2e-07	30.7
LXL04_018281	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	130	293	5.7e-12	46.1
LXL04_018281	`PF13964.13`	Beta-prop_Calicin	142	265	7.7e-14	52.1
LXL04_018281	`PF25210.2`	Kelch_FKB95	155	335	4.9e-20	73.0
LXL04_018281	`PF01344.32`	Kelch_1	161	201	1.9e-28	98.3
LXL04_018281	`PF24981.2`	Beta-prop_ATRN-LZTR1	169	247	6.1e-08	33.0
LXL04_018281	`PF24981.2`	Beta-prop_ATRN-LZTR1	169	252	6.1e-08	33.0
LXL04_018281	`PF01344.32`	Kelch_1	204	251	1.9e-28	98.3
LXL04_018281	`PF07646.22`	Kelch_2	210	250	1.5e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W93`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g55270	71.564%	Swiss-Prot	strong database homology
`Q9C6Z0`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g30090	28.803%	Swiss-Prot	weak database homology
`Q9LM55`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g22040	28.375%	Swiss-Prot	weak database homology
`Q8LAW2`	Arabidopsis thaliana	F-box protein AFR	24.047%	Swiss-Prot	weak database homology
`Q9FZJ3`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At1g27420	27.562%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card