TkA08G003610 | RubberDandelionOmics

Gene overview

TkA08G003610

Reference: TK1151 Chr: Chr08 Coordinates: 930542-931138 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

561 bp · TkA08G003610|TK1151|cDNA

ATGGAAGCCATATCCACCCCTGTTTCATCCATCAGTGTTCATAAGATACATCCAAAAACCCATCACTTTTACCACCTCAAACCTCCCCCTCTTCTTCCCTACCCCCATGGCCACGTATCTACTACTACGGCGGCGGTCGGGAAAACACCCAGACCGGTATCAAATAAAACCACTCCCTCTTATCGCCACAAGCTCAACCCAAGTACCCAACTTCACCACCGGAACGCCGCGACTGGCTATGCAGCGGCGCTAATAGACGC...

CDS

Download CDS FASTA

561 bp · TkA08G003610|TK1151|CDS

ATGGAAGCCATATCCACCCCTGTTTCATCCATCAGTGTTCATAAGATACATCCAAAAACCCATCACTTTTACCACCTCAAACCTCCCCCTCTTCTTCCCTACCCCCATGGCCACGTATCTACTACTACGGCGGCGGTCGGGAAAACACCCAGACCGGTATCAAATAAAACCACTCCCTCTTATCGCCACAAGCTCAACCCAAGTACCCAACTTCACCACCGGAACGCCGCGACTGGCTATGCAGCGGCGCTAATAGACGC...

Protein

Download Protein FASTA

186 aa · TkA08G003610|TK1151|PROTEIN

MEAISTPVSSISVHKIHPKTHHFYHLKPPPLLPYPHGHVSTTTAAVGKTPRPVSNKTTPSYRHKLNPSTQLHHRNAATGYAAALIDAALCSNSLDVVYKDVKRLLKWLQCNEMLKGMMTDPSMKESVKGKVIKEVSKKAKFQRQVVVLLKMLVAKNKSGMVAQVMEEFERIYHELNSGLRVGGAKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G003610`
TK1151 ID	TkA08G003610
OH-1004 ID	LXL04_026628
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G003610`
Location	Chr08:930542-931138 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026628` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009409 response to cold Biological Process GO:0009772 photosynthetic electron transport in photosystem II Biological Process GO:0009773 photosynthetic electron transport in photosystem I Biological Process GO:0015979 photosynthesis Biological Process GO:0015986 proton motive force-driven ATP synthesis Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009579 thylakoid Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0010287 plastoglobule Cellular Component
KEGG gene cross-reference	ath:AT4G09650 cre:CHLRE_11g467569v5 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.835

Rank 1 · TkA08G003610 · TK1151

Mitochondrion0.103

Rank 2 · TkA08G003610 · TK1151

Nucleus0.050

Rank 3 · TkA08G003610 · TK1151

Cytoplasm0.016

Rank 4 · TkA08G003610 · TK1151

Cell membrane0.009

Rank 5 · TkA08G003610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00213OSCP77-177 aa

PF27310HrcA_C_epsilon89-176 aa

PF27601DCAF1_4th100-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G003610	`PF00213`	OSCP	77	177	6.2e-16	59.7
TkA08G003610	`PF27310`	HrcA_C_epsilon	89	176	0.066	13.5
TkA08G003610	`PF27601`	DCAF1_4th	100	162	0.0095	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card