LXL04_026628 | RubberDandelionOmics

Gene overview

LXL04_026628

Reference: OH-1004 Chr: Chr06 Coordinates: 492355-492951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

597 bp · LXL04_026628|LXL04_026628|OH1004|cDNA

ATGGAAGCCATATCCACCCCTGTTTCATCCATCAGTGTTCATAAGATACATCCAAAAACCCATCACTTTTACCACCTCAAACCTCCCCCTCTTCTTCCCTACCCCCATGGCCACGTATCTACTACTACGGCGGCGGTCGGGAAAACACCCAGACCGGTATCAAATAAAACCACTCCCTCTTATCGCCACAAGCTCAACCCAAGTACCCAACTTCAGTCTGCCTCTGAACCAATTCTATCCCCCACCCAGACCCACCGGAA...

CDS

Download CDS FASTA

597 bp · LXL04_026628|LXL04_026628|OH1004|CDS

ATGGAAGCCATATCCACCCCTGTTTCATCCATCAGTGTTCATAAGATACATCCAAAAACCCATCACTTTTACCACCTCAAACCTCCCCCTCTTCTTCCCTACCCCCATGGCCACGTATCTACTACTACGGCGGCGGTCGGGAAAACACCCAGACCGGTATCAAATAAAACCACTCCCTCTTATCGCCACAAGCTCAACCCAAGTACCCAACTTCAGTCTGCCTCTGAACCAATTCTATCCCCCACCCAGACCCACCGGAA...

Protein

Download Protein FASTA

198 aa · LXL04_026628|LXL04_026628|OH1004|PROTEIN

MEAISTPVSSISVHKIHPKTHHFYHLKPPPLLPYPHGHVSTTTAAVGKTPRPVSNKTTPSYRHKLNPSTQLQSASEPILSPTQTHRNAATGYAAALIDAALCSNSLDVVYKDVKRLLKWLQCNEMLKGMMTDPSMKESVKGKVIKEVSKKAKFQRQVVVLLKMLVAKNKSGMVAQVMEEFERIYHELNSGLRVGGAKC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026628`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026628

Location Chr06:492355-492951 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09650`	F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient.	Knock-out of the genes coding for the Rieske protein and the ATP-synthase delta-subunit of Arabidopsis. Effects on photosynthesis, thylakoid protein composition, and nuclear chloroplast gene expression.2003 · DOI: 10.1104/pp.103.024190

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026628 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT4G09650

cre:CHLRE_11g467569v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.863

Rank 1 · LXL04_026628 · OH-1004

Mitochondrion0.087

Rank 2 · LXL04_026628 · OH-1004

Nucleus0.050

Rank 3 · LXL04_026628 · OH-1004

Cytoplasm0.016

Rank 4 · LXL04_026628 · OH-1004

Cell membrane0.009

Rank 5 · LXL04_026628 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00213.24OSCP89-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026628	`PF00213.24`	OSCP	89	189	7.2e-16	59.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSS9`	Arabidopsis thaliana	ATP synthase subunit delta, chloroplastic	27.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card