TkA08G001440 | RubberDandelionOmics

Gene overview

TkA08G001440

Reference: TK1151 Chr: Chr08 Coordinates: 371514-371852 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA08G001440|TK1151|cDNA

ATGGCCTTTGGCTTGGGAGAAACGCGTGTGATCGTGACATGCAACCCCGACGTCGCCAAGGATATCCTTAACAGCTCTGCTTTTGCCGACCGCCCTATCAAGGAGTCGGCATACAGCCTGAATGTCGACCGGGCCATTGGGTTTGCGCCATATGGCGTTTACTGGCGGACGTTACGACGGATTGCAGCCTCGCATCTCTTCTGTCCCAAGCAAATCAAGGTCTCCGAAGGCCAGAGAATTGTGGTTTCTTATCATATGGT...

CDS

Download CDS FASTA

339 bp · TkA08G001440|TK1151|CDS

ATGGCCTTTGGCTTGGGAGAAACGCGTGTGATCGTGACATGCAACCCCGACGTCGCCAAGGATATCCTTAACAGCTCTGCTTTTGCCGACCGCCCTATCAAGGAGTCGGCATACAGCCTGAATGTCGACCGGGCCATTGGGTTTGCGCCATATGGCGTTTACTGGCGGACGTTACGACGGATTGCAGCCTCGCATCTCTTCTGTCCCAAGCAAATCAAGGTCTCCGAAGGCCAGAGAATTGTGGTTTCTTATCATATGGT...

Protein

Download Protein FASTA

112 aa · TkA08G001440|TK1151|PROTEIN

MAFGLGETRVIVTCNPDVAKDILNSSAFADRPIKESAYSLNVDRAIGFAPYGVYWRTLRRIAASHLFCPKQIKVSEGQRIVVSYHMVEMLRHHQHQISSVCVSPSFQASLSQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G001440`
TK1151 ID	TkA08G001440
OH-1004 ID	LXL04_026626
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 99.107 / OH-1004 21.580 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G001440

Location Chr08:371514-371852 (+)

Description Similar to CYP78A6: Cytochrome P450 78A6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61880`	Plays a role in seed and fruit development.	Overexpression of a gene encoding a cytochrome P450, CYP78A9, induces large and seedless fruit in arabidopsis.2000 · DOI: 10.1105/tpc.12.9.1541 Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At2g46660`	Plays a role in seed and fruit development.	Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At1g13710`	Plays a role in regulating directional growth at the meristem/organ boundary.	CYP78A5 encodes a cytochrome P450 that marks the shoot apical meristem boundary in Arabidopsis.1999 · DOI: 10.1046/j.1365-313x.1999.00523.x Control of plant organ size by KLUH/CYP78A5-dependent intercellular signaling.2007 · DOI: 10.1016/j.devcel.2007.10.001 Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180 KLUH/CYP78A5-dependent growth signaling coordinates floral organ growth in Arabidopsis.2010 · DOI: 10.1016/j.cub.2010.01.039
`At5g09970`	Functions probably in association with CYP78A5 in regulating relative growth of the shoot apical meristem and plant organs via a non-cell-autonomous signal.	Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026626 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009791 post-embryonic development Biological Process

GO:0010154 fruit development Biological Process

GO:0048316 seed development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT2G46660

ath:AT3G61880

ath:AT5G09970

gmx:100799906

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.885

Rank 1 · TkA08G001440 · TK1151

Cytoplasm0.089

Rank 2 · TkA08G001440 · TK1151

Lysosome / Vacuole0.036

Rank 3 · TkA08G001440 · TK1151

Cell membrane0.034

Rank 4 · TkA08G001440 · TK1151

Plastid0.032

Rank 5 · TkA08G001440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4503-98 aa

PF03625DUF3026-25 aa

PF03625DUF30265-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G001440	`PF00067`	p450	3	98	0.00012	21.7
TkA08G001440	`PF03625`	DUF302	6	25	0.21	12.2
TkA08G001440	`PF03625`	DUF302	65	98	0.21	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLP1`	Arabidopsis thaliana	sp\|Q9SLP1\|C78A9_ARATH Cytochrome P450 78A9	75.600%	Swiss-Prot	High
`Q9ZNR0`	Arabidopsis thaliana	sp\|Q9ZNR0\|C78A6_ARATH Cytochrome P450 78A6	75.600%	Swiss-Prot	High
`Q9LMX7`	Arabidopsis thaliana	sp\|Q9LMX7\|C78A5_ARATH Cytochrome P450 78A5	53.800%	Swiss-Prot	High
`Q9FIB0`	Arabidopsis thaliana	sp\|Q9FIB0\|C78A7_ARATH Cytochrome P450 78A7	49.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card