LXL04_026626 | RubberDandelionOmics

Gene overview

LXL04_026626

Reference: OH-1004 Chr: Chr06 Coordinates: 255344-257206 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · LXL04_026626|LXL04_026626|OH1004|cDNA

ATGAGAACCAACATCGACACTCTCTGGCTTTTTGCCCTCGCCTCTAAATGCACTTCCATCAACTTCTTCGTTATCCTTGCTCTCGCCTGCTTCATTAACTGCTTCTTCCAATGGCCAAAACACAAATCCACCATCCCCGGTCCGAGAGGCTTCCCTTTCATCGGCAGCATGCATCTCATGTCTGGCCTCGCTCACCGTAAGCTCGCCGCCGCCGCACACTCATGCCGTGCCCACCGCCTGATGGCCTTTGGCTTGGGAGA...

CDS

Download CDS FASTA

1560 bp · LXL04_026626|LXL04_026626|OH1004|CDS

ATGAGAACCAACATCGACACTCTCTGGCTTTTTGCCCTCGCCTCTAAATGCACTTCCATCAACTTCTTCGTTATCCTTGCTCTCGCCTGCTTCATTAACTGCTTCTTCCAATGGCCAAAACACAAATCCACCATCCCCGGTCCGAGAGGCTTCCCTTTCATCGGCAGCATGCATCTCATGTCTGGCCTCGCTCACCGTAAGCTCGCCGCCGCCGCACACTCATGCCGTGCCCACCGCCTGATGGCCTTTGGCTTGGGAGA...

Protein

Download Protein FASTA

519 aa · LXL04_026626|LXL04_026626|OH1004|PROTEIN

MRTNIDTLWLFALASKCTSINFFVILALACFINCFFQWPKHKSTIPGPRGFPFIGSMHLMSGLAHRKLAAAAHSCRAHRLMAFGLGETRVIVTCNPDVAKDILNSSAFADRPIKESAYSLMFDRAIGFAPYGVYWRTLRRIAASHLFCPKQIKVSEGQRIVVSYQMVEMLRHHQQQISSVCVRQVFKRASLSNMMWSVFGRRYRLESNDVESAEMRKLVEEGYEVLGMLNWTDHLPWVADFDLQGIRSRCSKLLPKVNRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026626`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026626

Location Chr06:255344-257206 (+)

Description Similar to CYP78A6: Cytochrome P450 78A6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46660`	Plays a role in seed and fruit development.	Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At3g61880`	Plays a role in seed and fruit development.	Overexpression of a gene encoding a cytochrome P450, CYP78A9, induces large and seedless fruit in arabidopsis.2000 · DOI: 10.1105/tpc.12.9.1541 Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1365-313x.2012.04907.x
`At5g09970`	Functions probably in association with CYP78A5 in regulating relative growth of the shoot apical meristem and plant organs via a non-cell-autonomous signal.	Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.2008 · DOI: 10.1105/tpc.108.058180

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026626 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009791 post-embryonic development Biological Process

GO:0010154 fruit development Biological Process

GO:0048316 seed development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT2G46660

ath:AT3G61880

ath:AT5G09970

gmx:100799906

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.856

Rank 1 · LXL04_026626 · OH-1004

Plastid0.072

Rank 2 · LXL04_026626 · OH-1004

Cell membrane0.046

Rank 3 · LXL04_026626 · OH-1004

Cytoplasm0.037

Rank 4 · LXL04_026626 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_026626 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45046-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026626	`PF00067.28`	p450	46	487	4.3e-79	267.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZNR0`	Arabidopsis thaliana	Cytochrome P450 78A6	62.289%	Swiss-Prot	strong database homology
`Q9SLP1`	Arabidopsis thaliana	Cytochrome P450 78A9	68.565%	Swiss-Prot	strong database homology
`Q9FIB0`	Arabidopsis thaliana	Cytochrome P450 78A7	52.790%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card