TkA07G443480 | RubberDandelionOmics

Gene overview

TkA07G443480

Reference: TK1151 Chr: Chr07 Coordinates: 112460650-112462131 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1234 bp · TkA07G443480|TK1151|cDNA

CTCTCTCTCTCTTGCTATCTCTTGTCTGATTCGCTCTTTAAGATTTCAAAAAGTTATATGCACAGATAAACAAAGGGACGAAAGCCAAAAGGAAAACGCGTATCAATTGGTTAAAGATCCGCATCATCGTCGTCGTCATTCTCTGAAACTGAAGATATCGATATTATGTGCATTGATTTCAATTTTGATTTGCCTTTGATAGCAACAATTCACCATTTCTCATGATCCTATTGCTCTGAAATCTGAACTATTCTTCGCGC...

CDS

Download CDS FASTA

642 bp · TkA07G443480|TK1151|CDS

ATGGGGAAAACAGGAAGAGATTGGACTCAGATCTACGCCATCTACGGCATGGACGATTGGCAAACACCGGTGTTCCTCCTACTCCACGCGATCTTCTTCTCAGTCTCATCAGTCCTCTTTCTAATTTACTTTGACTGGATCTGCTCTTCCTTCGAGTCGATTCTCCCCGCCGTTTTTTCCACCGGTTTCGCTAGATTCTCCGCCGGATTCACCGGCTCCGTCACAGCTCTCTCCGGCGTATGCCTTTTTTACGCAGCCGG...

Protein

Download Protein FASTA

213 aa · TkA07G443480|TK1151|PROTEIN

MGKTGRDWTQIYAIYGMDDWQTPVFLLLHAIFFSVSSVLFLIYFDWICSSFESILPAVFSTGFARFSAGFTGSVTALSGVCLFYAAGNIFYSSVALRWDMAQRMVGAVHDWSTVKTALDVGCGRGILLNTVAMQLKKEGSSGRVVGLDRKDTTLSTLRTAGMEGVQEYVTCRAGDARRLPFPDNYFDVVVSAGFLHTVGKEFGQKKRRRRRNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G443480`
TK1151 ID	TkA07G443480
OH-1004 ID	LXL04_030984
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.244 / OH-1004 42.797 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G443480`
Location	Chr07:112460650-112462131 (+)
Description	Similar to menG: Demethylmenaquinone methyltransferase (Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030984` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009234 menaquinone biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0046685 response to arsenic-containing substance Biological Process GO:0008168 methyltransferase activity Molecular Function GO:0030791 arsenite methyltransferase activity Molecular Function GO:0043770 demethylmenaquinone methyltransferase activity Molecular Function
KEGG gene cross-reference	ljo:LJ_0053 lmh:LMHCC_0625 lmo:lmo1931 lwe:lwe1957 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.444

Rank 1 · TkA07G443480 · TK1151

Endoplasmic reticulum0.229

Rank 2 · TkA07G443480 · TK1151

Cytoplasm0.117

Rank 3 · TkA07G443480 · TK1151

Plastid0.104

Rank 4 · TkA07G443480 · TK1151

Nucleus0.086

Rank 5 · TkA07G443480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_2983-190 aa

PF13679Methyltransf_32103-156 aa

PF01135PCMT111-155 aa

PF01209Ubie_methyltran112-192 aa

PF05175MTS113-191 aa

PF01728FtsJ113-193 aa

PF13489Methyltransf_23114-198 aa

PF02353CMAS115-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G443480	`PF03141`	Methyltransf_29	83	190	0.0091	15.3
TkA07G443480	`PF13679`	Methyltransf_32	103	156	0.0027	18.4
TkA07G443480	`PF01135`	PCMT	111	155	0.023	15.2
TkA07G443480	`PF01209`	Ubie_methyltran	112	192	8.5e-05	22.7
TkA07G443480	`PF05175`	MTS	113	191	0.028	14.7
TkA07G443480	`PF01728`	FtsJ	113	193	0.074	13.7
TkA07G443480	`PF13489`	Methyltransf_23	114	198	0.01	16.3
TkA07G443480	`PF02353`	CMAS	115	201	0.35	10.9
TkA07G443480	`PF13847`	Methyltransf_31	116	199	9.4e-10	39.2
TkA07G443480	`PF05185`	PRMT5	117	191	0.013	16.1
TkA07G443480	`PF07021`	MetW	117	192	0.041	14.2
TkA07G443480	`PF08241`	Methyltransf_11	118	200	4.4e-13	50.4
TkA07G443480	`PF13649`	Methyltransf_25	118	199	1.8e-12	48.5
TkA07G443480	`PF08242`	Methyltransf_12	118	198	8e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card