LXL04_030984 | RubberDandelionOmics

Gene overview

LXL04_030984

Reference: OH-1004 Chr: Chr06 Coordinates: 126262085-126267204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1440 bp · LXL04_030984|LXL04_030984|OH1004|cDNA

ATGTTAATTGCTTCCATTGAAACTGCAGAATCTGAGCTTGAGAACGTCGAGCTGCACATCTGTTACTGTTACTTTATAGAGAGAATGGGGAAAACAGGAAGAGATTGGACTCAGATCTACGCCATCTACGGCATGGACGATTGGCAAACACCGGTGTTCCTCCTACTCCACGCGATCTTCTTCTCAGTCTCATCAGTCCTCTTTCTAATTTACTTTGACTGGATCTGCTCTTCCTTCGAGTCGATTCTCCCCGCCGTTTT...

CDS

Download CDS FASTA

1440 bp · LXL04_030984|LXL04_030984|OH1004|CDS

ATGTTAATTGCTTCCATTGAAACTGCAGAATCTGAGCTTGAGAACGTCGAGCTGCACATCTGTTACTGTTACTTTATAGAGAGAATGGGGAAAACAGGAAGAGATTGGACTCAGATCTACGCCATCTACGGCATGGACGATTGGCAAACACCGGTGTTCCTCCTACTCCACGCGATCTTCTTCTCAGTCTCATCAGTCCTCTTTCTAATTTACTTTGACTGGATCTGCTCTTCCTTCGAGTCGATTCTCCCCGCCGTTTT...

Protein

Download Protein FASTA

479 aa · LXL04_030984|LXL04_030984|OH1004|PROTEIN

MLIASIETAESELENVELHICYCYFIERMGKTGRDWTQIYAIYGMDDWQTPVFLLLHAIFFSVSSVLFLIYFDWICSSFESILPAVFSTGFARFSAGFTGSVTALSGVCLFYAAGNIFYSSVALRWDMAQRMVGAVHDWSTVKTALDVGCGRGILLNTVAMQLKKEGSSGRVVGLDRKDTTLSTLRTAGMEGVQEYVTCRAGDARRLPFPDNYFDVVVSAGFLHTVGKEFGQKTAAAAAERMRVLGEVVRVLKGGEIGVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030984`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_030984`
Location	Chr06:126262085-126267204 (+)
Description	Similar to menG: Demethylmenaquinone methyltransferase (Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030984` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0009234 menaquinone biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0046685 response to arsenic-containing substance Biological Process GO:0008168 methyltransferase activity Molecular Function GO:0030791 arsenite methyltransferase activity Molecular Function GO:0043770 demethylmenaquinone methyltransferase activity Molecular Function
KEGG gene cross-reference	ljo:LJ_0053 lmh:LMHCC_0625 lmo:lmo1931 lwe:lwe1957 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.277

Rank 1 · LXL04_030984 · OH-1004

Cytoplasm0.242

Rank 2 · LXL04_030984 · OH-1004

Endoplasmic reticulum0.230

Rank 3 · LXL04_030984 · OH-1004

Nucleus0.186

Rank 4 · LXL04_030984 · OH-1004

Cell membrane0.130

Rank 5 · LXL04_030984 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13847.13Methyltransf_31144-274 aa

PF08241.19Methyltransf_11146-255 aa

PF13649.13Methyltransf_25146-237 aa

PF08242.19Methyltransf_12146-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030984	`PF13847.13`	Methyltransf_31	144	274	5.4e-12	46.4
LXL04_030984	`PF08241.19`	Methyltransf_11	146	255	8.7e-15	55.9
LXL04_030984	`PF13649.13`	Methyltransf_25	146	237	9.8e-13	49.3
LXL04_030984	`PF08242.19`	Methyltransf_12	146	239	6.9e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card