TkA07G442850 | RubberDandelionOmics

Gene overview

TkA07G442850

Reference: TK1151 Chr: Chr07 Coordinates: 112228675-112231967 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1670 bp · TkA07G442850|TK1151|cDNA

TAAACACCTATAAAATGAACGTTTGCAAAAGAAGATGTGGTTCATCGATCGACACTCGACACTTTTCTCTTCTACAACGAATACCATCACTCTCGGAAGCTATGAGTTTGAGTATCAATGGAAATTATAGCAGCCATGGAGTTCCATATCGCGTCATCTCACGCTATCATCGCCCACAGAGAAGCATATCTGGAACGTATGTACTTCCAATCAAAATGATGAAGAAATCGCTCGATAAACACCACGACGACTCCGCAAAT...

CDS

Download CDS FASTA

744 bp · TkA07G442850|TK1151|CDS

ATGTATTCAGCTGGACAACAAGCAAATGAAGCTGTTCAGATCCAGCTAGGAGCTCTAAGTATAACCAGTTTGGCAGTTATATTTGGTGCGGGTTTAGTAACTAGCCTTTCACCTTGTACTCTAAGCGTTCTACCATTGACCCTAGGTTATATTGGCGCATTTGGATCTGGAAAAAGTAGAGCCGAGATTGTCGGCGACTCTCTTGCTTTTGCATTTGGTTTGGCGACGACGCTAGCGTTACTTGGTGTAGCCGCCTCTTT...

Protein

Download Protein FASTA

247 aa · TkA07G442850|TK1151|PROTEIN

MYSAGQQANEAVQIQLGALSITSLAVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEIVGDSLAFAFGLATTLALLGVAASFAGKAYGQVGQGLPLAASGLAVIMGLNLLEVIELQMPSFLDNFDPRAAAANFPSSVQAYLAGLTFALAASPCSTPVLATLLGYVAASKDPIIGGSLLLTYTTGYVAPLLIAASFAGALQSLLSFRKFSAWINPMSGALLLGGGIYTLLDKTFPPTSMTMMM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G442850`
TK1151 ID	TkA07G442850
OH-1004 ID	LXL04_030979
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 79.167 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G442850

Location Chr07:112228675-112231967 (+)

Description Similar to CCDA2: Cytochrome c-type biogenesis ccda-like chloroplastic protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54290`	Required for the transfer of reducing equivalents from stroma to thylakoid lumen.	A homolog of prokaryotic thiol disulfide transporter CcdA is required for the assembly of the cytochrome b6f complex in Arabidopsis chloroplasts.2004 · DOI: 10.1074/jbc.m404285200 CcdA is a thylakoid membrane protein required for the transfer of reducing equivalents from stroma to thylakoid lumen in the higher plant chloroplast.2010 · DOI: 10.1089/ars.2010.3138

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0137300`	Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.	No verified direct reference in this release
`Os11g0140800`	Probably involved in the transfer of reducing equivalents from stroma to thylakoid lumen and required for the biogenesis of the plastid cytochrome b6f complex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010190 cytochrome b6f complex assembly Biological Process

GO:0017004 cytochrome complex assembly Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0055035 plastid thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT5G54290

dosa:Os11g0140800

dosa:Os12g0137300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · TkA07G442850 · TK1151

Mitochondrion0.026

Rank 2 · TkA07G442850 · TK1151

Peroxisome0.021

Rank 3 · TkA07G442850 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA07G442850 · TK1151

Cytoplasm0.020

Rank 5 · TkA07G442850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02683DsbD_TM22-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G442850	`PF02683`	DsbD_TM	22	204	1.9e-23	83.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M5P3`	Arabidopsis thaliana	sp\|Q9M5P3\|CCDA_ARATH Cytochrome c-type biogenesis ccda-like chloroplastic protein	84.500%	Swiss-Prot	High
`Q2QY07`	Oryza sativa subsp. japonica	sp\|Q2QY07\|CCDA2_ORYSJ Cytochrome c-type biogenesis ccda-like chloroplastic protein 2	87.300%	Swiss-Prot	High
`Q2RAR6`	Oryza sativa subsp. japonica	sp\|Q2RAR6\|CCDA1_ORYSJ Cytochrome c-type biogenesis ccda-like chloroplastic protein 1	87.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card